CAZyme Information: OAT03326.1

Basic Information

• Species: Blastomyces gilchristii
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Blastomyces; Blastomyces gilchristii
• CAZyme ID: OAT03326.1
• CAZy Family: AA1
• CAZyme Description: DUF821 domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
449	GG657448|CGC4	50939.80	7.6828

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BgilchristiiSLH14081	10148	559298	456	9692

• Gene Location: location=GG657448:380096-381534(+)

Full Sequence      

MVLLGLSGRYFTLAVIAAVFISGILYASFYHIFNGLSYQPKSQSQLPPCRPVIPAAGSNN
NGGACPGDAPWKFETERDGDNYGLSRAQCQKAFPKLYVEIEKAVVARRGRNITFDELNSK
PLKTSMVRAMVYQGALYVINFEDMRYTFSRAKASLNALNRAISAIPNPNEIPNIEFIFTT
EDFHDDPHPVWVYSKREDDGWAWLMPDFGYWSWPEIKAGQYRSVRQRIAAIDEGTVINGK
AHPPLKFQDKKKQLLWRGAIATAPELRQGLVDATKGKSWASVRPLTWADEKSMQENFIPI
EDHCRYMFVAHVEGRSYSGRGKYLQNCRSVMVAHQLNWREAHHGALVAAGPDANYVKVKR
DFSDLESKMNYLLDNPDVAERIAENSVRTFRDRYLTPAAEACYWRELMHAYASMCDFEPV
LYTDSSGDPNSARGVPFESFVLDWKLPES

Enzyme Prediction     

No EC number prediction in OAT03326.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	173	415	6.3e-27	0.976

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	3.94e-18	168	419	76	327	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	1.53e-15	170	412	1	250	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS64975.1|GT0	1.28e-282	1	447	1	451
QSS70846.1|GT0	3.66e-282	1	447	1	451
BCS13796.1|GT0	2.35e-169	71	442	68	439
BCS02108.1|GT0	2.35e-169	71	442	68	439
UDD61446.1|GT0	2.55e-165	64	442	57	436

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	1.07e-11	171	417	117	344	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	5.12e-08	124	418	78	382	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q16QY8|RUMI_AEDAE	8.81e-15	120	418	84	391	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	9.16e-12	166	418	132	392	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	6.53e-11	171	417	145	372	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	3.65e-10	171	417	145	372	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	6.47e-10	171	417	145	372	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000002

TMHMM  Annotations     

Start	End
7	29