CAZyme Information: OAG26635.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG26635.1
• CAZy Family: PL4
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
996		102824.19	5.1492

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441469:2468685-2471808(+)

Full Sequence      

MSPSTFTRAAFAAGLLASGVSAAFDNAAKTNIAMYWGQGNAQIPLSEVCADPNIDIVNIG
FINAFPSVVGSYPGSNHANACGSEVYYDPVLKKDSKLYSSCPGVGDAITACQKSGKKVML
SLGGGWPTDYYLPSPEVAQWTAEFLIKAYGPPTAAWKAAGRPRPFGDAVVDGFDLDLEAQ
TYDMPSAEYIYKNYDVFGKYVKSNSKMLLSAAPQCVVPDVRISPVLKAVPFDFIFTQFYN
TRVCSAAQAVQDIKDKKTGTFTFDKWISEIKASANPNLKFYIGLAAGPDGLPTHKEDYLT
PEDANTLITKYKGNTNFGGVMLWEASVSVRNPTYGRSYGTWMKYAVEGTFLKNYKPIVSS
STRSSTTSTKASTTKTPSSTPVTSTKTSSTKSSSTKISSSTPISSSKIPSSTPVTSTKSS
STKISSSTPISSSKIPSSTPTPSTMITSSKTSSSAYVTSSMVSSSAYVTSSSISSSSSSS
SAYETASTKSSSSAETVSSTLIEPSSIATISASASSSESAYVPYPTETASSVETISSSAT
ESSSIDTISATKEGSSVYVPYPTETPSSVETVSSTFIEPSSIATISASETLSSSVYVPSS
SETSASTDKYPTDTVSATTPEGVSSTSCSTSSVAYSTGASSSDVYSVSSVVYSSGVYSTA
SPVYPTSTYSASKGIDYPDYPAESSKSDAASSTGYESVPSVTKKPEYSEYSTAPTGSTTA
TVITTTYVDVCPTGLTTVTTTYWTTVCTKCAAKPTGSADVPEGWTTSVYTASTVTVTLTK
PIVTPTSMPAYPSSAPSVAYPADYPAKPVSSGKPGYPAVPEASMPAYPAAPKPSKAAEYP
AVPEASKGAEYPSAPQGSMPAYPAVPEASKAAEYPAMPEAPKPASSSAAAGYPSAPIASE
YPKKPVEQEVTSTVRVTSTLSKVAVPTYAPAPYPTVSAGGAPYVPAGSASSYAPMPTGTG
VGSAYPSMPAEFTGAASRAGDGFMMVVGVVAAVLVL

Enzyme Prediction     

EC	3.2.1.14:3

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	9.37e-97	30	337	1	277	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
395573	Glyco_hydro_18	3.59e-13	31	326	1	305	Glycosyl hydrolases family 18.
223021	PHA03247	8.87e-13	678	978	2589	2879	large tegument protein UL36; Provisional
223021	PHA03247	2.54e-11	785	981	2569	2754	large tegument protein UL36; Provisional
237057	PRK12323	2.45e-09	756	958	370	579	DNA polymerase III subunit gamma/tau.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7206096.1|GH18	1.30e-180	1	996	1	1151
CBX94753.1|GH18	1.59e-144	1	996	1	933
QRC91362.1|CBM18|GH18	1.01e-91	1	350	1	357
SMR49362.1|GH18	1.73e-91	5	347	3	350
SMR48152.1|GH18	1.70e-90	3	343	2	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4TX6_A	2.02e-70	29	343	1	305	AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163],4TX6_B AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163]
2XVN_A	5.14e-70	30	343	1	304	A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_B A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_C A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus]
2XTK_A	5.30e-70	30	343	2	305	ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XTK_B ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XUC_A Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_B Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_C Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XVP_A ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163],2XVP_B ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163]
2UY2_A	4.50e-39	25	338	1	279	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
2GSJ_A	8.26e-33	32	324	3	254	cDNA cloning and 1.75A crystal structure determination of PPL2, a novel chimerolectin from Parkia platycephala seeds exhibiting endochitinolytic activity [Parkia platycephala]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q873Y0|CHIA1_ASPFM	5.47e-67	20	367	19	354	Endochitinase A1 OS=Neosartorya fumigata OX=746128 GN=chiA1 PE=1 SV=1
sp|Q4WEP7|CHIA1_ASPFU	9.32e-67	20	367	19	354	Endochitinase A1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chiA1 PE=3 SV=1
sp|Q92223|CHIA1_EMEND	1.56e-66	1	338	1	328	Endochitinase A OS=Emericella nidulans OX=162425 GN=chiA PE=2 SV=3
sp|G5EB30|CHIA1_EMENI	1.56e-66	1	338	1	328	Endochitinase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chiA PE=1 SV=1
sp|A2QUQ2|CHIA1_ASPNC	1.92e-61	23	343	21	333	Endochitinase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=ctcA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000271	0.999701	CS pos: 22-23. Pr: 0.9804

TMHMM  Annotations     

There is no transmembrane helices in OAG26635.1.