CAZyme Information: OAG26377.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG26377.1
• CAZy Family: GT66
• CAZyme Description: CAP10 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A177E326]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
489	KV441469|CGC16	56709.71	7.3269

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441469:1829721-1831371(+)

Full Sequence      

MLMKKMWIVEERKDKTVYRRRCPTGGEVLSFFFVSACALLFLLICTILYGTRTQNPSLPP
LVKEYMPAGRCLCEFSTTFSCDTCLDCASNQAILATNATELEQHNLWTFTYPRDKNNYGL
DEAQCDSAFPGQYEDIERAVKVRNRWGKVTQADLNSFELTKGMVRAMIYDRELYVLETHM
VDNVNRQKAIATLSAIYRAVLAAPSTADIPNIEFVFSVEDLPAQPAKPIWSLTRRVQDHN
LWLIPDFGFWSWDMPALGTLEEVAQEAVQRETVESWDQKIEKLVWRGKITFAPKLRRALL
DAAKGKPWSDVGQLKWTDPNFKEQFLGPVDQCNYMFIAHAEGRSYSGSLKYRQLCRSVIV
SHKLQWIQHHHYLFRSNGSNQNFVEVERDFSDLSSAMEDLLDHPEKAKRIADNSVQVFRE
RYLTQAAEACYWRKLMKRWRDVVDWEPQLYAGVGAEGTDRNREKRRGVRYETFMLYEPKV
QLSYPESAT

Enzyme Prediction     

No EC number prediction in OAG26377.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	209	442	7.8e-17	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.73e-15	209	439	2	249	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.34e-14	209	452	79	332	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7205608.1|GT0	0.0	1	488	1	486
QRC91380.1|GT0	3.57e-304	1	488	1	489
QSS76484.1|GT0	1.32e-134	46	485	26	457
QMW31614.1|GT0	7.58e-133	41	484	28	458
UDD60541.1|GT0	7.58e-133	41	484	28	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	9.46e-06	121	446	17	382	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7ZVE6|PLGT2_DANRE	2.80e-07	209	453	226	476	Protein O-glucosyltransferase 2 OS=Danio rerio OX=7955 GN=poglut2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000013

TMHMM  Annotations     

Start	End
28	50