CAZyme Information: OAG25940.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG25940.1
• CAZy Family: GT39
• CAZyme Description: GPI mannosyltransferas-like protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434	KV441469|CGC1	49514.96	9.8080

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441469:746978-748333(-)

Full Sequence      

MALSSFFRSPPLVFTTSVVLRAVFLIYGLWQDANSPMKYTDIDYYVFTDAARYISRGQSP
YARDTYRYTPLLAWLIYPTVWSGQFWFSFGKILFAVGDVATGWMMFRILKEYKKMSDERA
LKFASIWLLNPMVATISTRGSSEGLLGVFVTALLWAVLAKQRPLAGFLLGFAVHFKIYPF
IYAASIVWFLDDTQMEVEGAAQAQSAPSLFGRMRNFLNPARIYLALYSLLTFASLNLLMY
SMYGWPFLEHSYLYHVTRSDHRHNFSPYNTLLYLKSSPKPANVGPATQSFGLERLAFLPQ
LLLSAVFTPLVLAKKDLPNTMLAQTFAFVTFNKVCTSQYFLWYMMFLPYYLPDSTLLQSS
SIGIPALVFWIVGQVAWLQQGFQLEFNGHSTFVPGLWVSSIIFFLVNSVILGIIIYDTKQ
KRPHGNVVVEKKAL

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	136	415	2.3e-93	0.9961832061068703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	8.39e-88	17	416	15	416	GPI mannosyltransferase
252941	Mannosyl_trans	6.19e-72	136	415	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
399599	PIG-U	1.14e-09	49	264	39	250	GPI transamidase subunit PIG-U. Many eukaryotic proteins are anchored to the cell surface via glycosylphosphatidylinositol (GPI), which is posttranslationally attached to the carboxyl-terminus by GPI transamidase. The mammalian GPI transamidase is a complex of at least four subunits, GPI8, GAA1, PIG-S, and PIG-T. PIG-U is thought to represent a fifth subunit in this complex and may be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7207511.1|GT50	1.77e-251	1	432	1	435
QRC91239.1|GT50	9.28e-236	1	433	1	428
CBX94852.1|GT50	2.32e-229	1	434	1	439
QDS69008.1|GT50	5.57e-181	7	420	5	409
SMR53900.1|GT50	1.41e-176	10	421	10	406

PDB Hits     

OAG25940.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2TXB8|GPI14_ASPOR	3.56e-168	3	417	1	409	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q5B7W0|GPI14_EMENI	1.25e-165	3	417	1	427	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q4WAH2|GPI14_ASPFU	1.35e-165	3	417	1	420	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	1.07e-161	2	427	3	417	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	2.43e-161	3	417	19	484	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999996	0.000001

TMHMM  Annotations     

Start	End
12	31
84	106
141	158
168	190
222	244
321	343
356	378
393	415