CAZyme Information: OAG25283.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG25283.1
• CAZy Family: PL1
• CAZyme Description: CBM1 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A177DZY9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
252		26789.71	4.6785

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441470:920436-921296(+)

Full Sequence      

MQYSTAALLALLTSTTYAAVGDWQQCGGMSWSGETTCSSGAGCVKINDYYSQCQPGAAPA
PTAEPQPDPVPEPTPTTFTTVSPGAPTVSSTPSGSGPGKTLQSGYYWIRAVAAPNFHKYF
QTKPLYSTGSALLGDYTTAGQFQVVDGQLVELVSAPGEPVKLLYAVVSEERSINGMSLAV
SFSESKNTYGTFAWGGDDLQWSVAGVNRPNKSAWYVCTGQKLYINLGNYLYQTPSGCADQ
TVHYYNDKTANN

Enzyme Prediction     

No EC number prediction in OAG25283.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
197593	fCBD	5.48e-10	23	54	3	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	2.29e-09	23	50	2	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7024509.1|CBM1	1.06e-139	1	252	1	249
QRC93954.1|CBM1	1.27e-119	1	252	1	248
CCD53258.1|CBM1	1.47e-69	2	249	6	244
ATZ47129.1|CBM1	1.47e-69	2	249	6	244
APA06164.1|CBM1	9.21e-69	8	249	12	247

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RV8_A	7.42e-09	18	60	3	45	Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor covalent complex with the aldouronic acid UXXR [Cerrena unicolor],6RV8_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor covalent complex with the aldouronic acid UXXR [Cerrena unicolor]
6Q8M_A	9.65e-08	13	53	368	405	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
4BMF_A	1.25e-06	23	53	7	37	Chain A, ENDOGLUCANASE EG-1 [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P46236|GUNB_FUSOX	1.79e-10	3	58	10	65	Putative endoglucanase type B OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|A1DBV1|MANF_NEOFI	3.23e-10	4	57	5	57	Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=manF PE=3 SV=1
sp|A1C8U0|MANF_ASPCL	1.03e-09	4	58	5	58	Mannan endo-1,4-beta-mannosidase F OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=manF PE=3 SV=1
sp|P0CT87|GCE1_PHACR	1.08e-09	6	58	8	60	4-O-methyl-glucuronoyl methylesterase 1 OS=Phanerochaete chrysosporium (strain RP-78 / ATCC MYA-4764 / FGSC 9002) OX=273507 GN=e_gw1.18.61.1 PE=1 SV=1
sp|A0A1D8EJG8|GCE1_SODAL	2.01e-09	6	60	7	61	4-O-methyl-glucuronoyl methylesterase 1 OS=Sodiomyces alcalophilus OX=398408 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000212	0.999751	CS pos: 18-19. Pr: 0.9803

TMHMM  Annotations     

There is no transmembrane helices in OAG25283.1.