CAZyme Information: OAG25019.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG25019.1
• CAZy Family: GT2
• CAZyme Description: alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
645	KV441470|CGC1	69814.41	4.9607

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441470:303521-305581(-)

Full Sequence      

MRFSNRTHGSNDTYDYIVVGSGPGGGPLAVNLAKAGFKTLLLEAGDDESAEKRTQALALS
EVPIPANLGWSFWVRHYDDDEQTKRYQRLTWRLPNGDLWVGPGSSAPAGAEMLGVQYPRG
ATLGGSTLVNAGFNILPSERDWSQIEALTGDSSWNPERMREIFAKTEKNLYLPRGTPGHG
FDGYLQLNEGNGTVFTTSPQSSEIYRSLVSEVGQNPDELEQLFDTDPNQLRSDRDQTVGL
FGGVFHANGTWGRYSVRDHVLATLRAVDATGRKRYPLEVRLNSLASKVLFEDSINGTAPR
AIGIEYLEGKSIYQGDLRYNASNNATTKQVYASKEVIVSGGTFNTPQLLLLSGIGSAADL
EALNITVVADLPGVGRNMQDHNEIATIGLAAQNISVDGGSGFPRSQCTPRAPNDPCYDLW
QQGQGPYAEGSIMGSMFFLKTNHSSTGERDIGMWSGPVGVRGFWPQTPNQSFVDPPNTFG
FHTVHMHGSNRAGYVKLRSADPTAQPEINFRHFSDEGADQDIAAIKEAVAFFRRVHAGVV
APVGPNEVIWPTCSGSVSADGTCSDEGNDEQFIRDNNYGHHATSTSSIGSDDDPNAVLDS
KFRVRGVEGLRVVDASAFPRAPGAFPVLAVFMLSEKAALDILSTQ

Enzyme Prediction     

No EC number prediction in OAG25019.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	13	642	1.3e-84	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	8.56e-51	10	642	2	532	choline dehydrogenase; Validated
225186	BetA	1.01e-45	28	645	22	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.99e-29	493	637	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	5.39e-17	1	642	43	577	Protein HOTHEAD
366272	GMC_oxred_N	7.83e-17	118	381	22	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPL03392.1|AA3	1.50e-296	12	643	34	639
UPK92979.1|AA3	1.98e-296	7	645	29	667
VBB79663.1|AA3	1.72e-207	10	643	31	660
QRC93226.1|AA3	2.56e-205	11	637	31	658
CDP27995.1|AA3	1.23e-203	10	643	31	655

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F97_A	4.70e-35	14	645	6	530	Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688],6F97_B Crystal structure of the V465T mutant of 5-(Hydroxymethyl)furfural Oxidase (HMFO) [Methylovorus sp. MP688]
4UDP_A	4.70e-35	14	645	6	530	Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDP_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the oxidized state [Methylovorus sp. MP688],4UDQ_A Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688],4UDQ_B Crystal structure of 5-hydroxymethylfurfural oxidase (HMFO) in the reduced state [Methylovorus sp. MP688]
4UDR_A	5.24e-34	14	645	6	530	Crystal structure of the H467A mutant of 5-hydroxymethylfurfural oxidase (HMFO) [Methylovorus sp. MP688],4UDR_B Crystal structure of the H467A mutant of 5-hydroxymethylfurfural oxidase (HMFO) [Methylovorus sp. MP688]
4H7U_A	4.75e-32	14	638	41	594	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
5OC1_A	1.56e-31	14	638	2	558	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6UPE0|CHDH_RAT	9.34e-39	9	638	41	573	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q8NE62|CHDH_HUMAN	1.01e-37	10	645	37	574	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|Q8BJ64|CHDH_MOUSE	1.56e-36	12	638	41	570	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q6LGH5|BETA_PHOPR	2.40e-35	11	642	2	531	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1
sp|A0A1U8QYA8|CICC_EMENI	4.87e-35	9	643	31	609	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999800	0.000247

TMHMM  Annotations     

There is no transmembrane helices in OAG25019.1.