CAZyme Information: OAG24658.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG24658.1
• CAZy Family: GT2
• CAZyme Description: heme peroxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404	KV441471|CGC9	44348.04	7.0139

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441471:1208500-1209766(-)

Full Sequence      

MKAFSYFSYALLTFVPLIEAHPGMGDTMNEMRYLAAREKRAASKELIGDLKTLADSKLTA
IGKDIKAIILDQTSAESATIDGSIPAGNIGSAACKADLCCHWKWLAYEMTAKFNGTSGRC
SKFARQAVRLGFHDAAVWSKSSSYGGADGSILLSDEMSRADNNGLSAIADQTKKWYTKYN
QYGMSMADIIQFGANVATVVCPLGPRLRTFVGRKDNSKAGPTGLLPGEKDSANKLIKLFQ
DKTIDAHDLVALVGAHTTSQQHFVDTTRDGDPQDSTPGIWDMAFYPQTTNNAPVRVIKFQ
SDINLSKDSRTSPSWQQFSDRATAQGRWNADYAKAYTRLSLLGVNNINDLKECTKVLPAE
RPTFVSEDQVLLDRWLNGEFDQLNNLVDDAIQLTGVISSREEKP

Enzyme Prediction     

No EC number prediction in OAG24658.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	109	344	5.3e-57	0.9647058823529412

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173826	ligninase	3.49e-110	90	363	6	293	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.
173823	plant_peroxidase_like	2.38e-30	128	340	22	254	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	6.70e-25	128	257	20	150	Peroxidase.
173825	ascorbate_peroxidase	5.85e-21	128	345	34	251	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.
173827	secretory_peroxidase	1.34e-18	128	344	37	283	Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7175176.1|AA2	1.82e-271	1	400	1	400
QRD06638.1|AA2	1.62e-235	1	398	1	399
CCF45286.1|AA2	1.45e-131	10	389	8	395
QDS77259.1|AA2	4.13e-125	18	385	16	386
UNI21317.1|AA2	3.46e-123	20	378	15	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q3U_A	4.86e-31	90	358	6	289	Trametes cervina lignin peroxidase [Trametopsis cervina]
1MN2_A	4.75e-30	99	362	14	298	Chain A, MANGANESE PEROXIDASE [Phanerodontia chrysosporium]
1MN1_A	4.75e-30	99	362	14	298	Chain A, MANGANESE PEROXIDASE [Phanerodontia chrysosporium]
1LGA_A	7.08e-30	99	362	14	294	Chain A, Lignin Peroxidase [Phanerodontia chrysosporium],1LGA_B Chain B, Lignin Peroxidase [Phanerodontia chrysosporium],1LLP_A Chain A, LIGNIN PEROXIDASE [Phanerodontia chrysosporium]
1MNP_A	9.04e-30	99	362	14	298	Chain A, Manganese Peroxidase [Phanerodontia chrysosporium],1YYD_A Chain A, Peroxidase manganese-dependent I [Phanerodontia chrysosporium],1YYG_A Chain A, Peroxidase manganese-dependent I [Phanerodontia chrysosporium],1YZP_A Chain A, Peroxidase manganese-dependent I [Phanerodontia chrysosporium],1YZR_A Chain A, Peroxidase manganese-dependent I [Phanerodontia chrysosporium],3M5Q_A Chain A, Manganese peroxidase 1 [Phanerodontia chrysosporium],3M8M_A Chain A, Manganese peroxidase 1 [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P11543|LIG5_PHACH	4.25e-29	99	362	41	320	Ligninase LG5 OS=Phanerodontia chrysosporium OX=2822231 GN=GLG5 PE=2 SV=1
sp|P49012|LIG2_PHACH	5.86e-29	99	362	42	322	Ligninase LG2 OS=Phanerodontia chrysosporium OX=2822231 GN=GLG2 PE=1 SV=1
sp|Q02567|PEM1_PHACH	6.55e-29	99	362	35	319	Manganese peroxidase 1 OS=Phanerodontia chrysosporium OX=2822231 GN=MNP1 PE=1 SV=1
sp|P06181|LIG8_PHACH	1.13e-28	99	362	42	322	Ligninase H8 OS=Phanerodontia chrysosporium OX=2822231 GN=LPOA PE=1 SV=1
sp|P20013|LIGC_TRAVE	1.56e-28	118	358	59	319	Ligninase C OS=Trametes versicolor OX=5325 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000863	0.999115	CS pos: 20-21. Pr: 0.9749

TMHMM  Annotations     

There is no transmembrane helices in OAG24658.1.