CAZyme Information: OAG24548.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG24548.1
• CAZy Family: GT2
• CAZyme Description: Six-hairpin glycosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368	KV441471|CGC2	40668.92	5.5677

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441471:925718-926877(+)

Full Sequence      

MAQSIISRNQGILASQTDSSALLQAGFVQKTFHHILSTYPNTSLAPTLDAYITKSVDSIV
PVVSNATRDATYPLDRLSSGNGLLQLWQETGEEKYRIAVEALRQSVDLQPRNNQGGLWYY
VYPYWSYLDGMFSLTPFLAAYTNDLGNSSTTETALEDMVLQLDLLWQHCYFEKTGLLVHG
YDASRTAVWANNVTGASPHVWGRSLGWYCMALIDTLELLPLAATHTRRYIETRFQQLMPA
VVEAADAKTGAWWQVMDRPGQEGNYLESSASSMFVYALLKGVRMGLLPTHAMSNGTVEVA
KRAYTYIADSFVVHNGNGTLGWNGTVGVCSLNSTASYEYYVGQPIVYNSVLGSAAFVRAS
LEVERLSI

Enzyme Prediction     

No EC number prediction in OAG24548.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	28	365	6.3e-78	0.9397590361445783

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	6.80e-64	70	367	75	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	4.33e-59	70	366	68	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7031832.1|GH105	5.21e-169	1	367	1	372
QRC92053.1|GH105	1.01e-165	1	368	34	396
QDS73972.1|GH105	1.42e-137	5	364	1	352
BCS25093.1|GH105	4.76e-130	1	364	35	407
QGA16534.1|GH105	5.48e-121	1	364	29	393

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.51e-63	31	366	30	361	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.09e-44	74	366	87	367	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	8.94e-44	74	366	77	357	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4XUV_A	7.61e-09	173	283	191	301	Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	1.07e-43	74	366	87	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	3.60e-30	136	362	4	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	3.60e-30	136	362	4	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999949	0.000072

TMHMM  Annotations     

There is no transmembrane helices in OAG24548.1.