CAZyme Information: OAG24208.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG24208.1
• CAZy Family: GT1
• CAZyme Description: 1,3-beta-glucan synthase component GLS2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1949	KV441471|CGC11	223019.28	8.1038

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

Full Sequence      

MSGHPQGGHYDDGYGQTQGHAQGQQGQDAYYHDDQYSQYHDDAHGAQYQQQGQHGDAYYD
EQGYYDGQQQGGHYQQNGYYDDRGQQGYQDEYYNDQYYDQGGAQDGYAANGQQPRRRQHD
SEEDSETFSDFTMRSDMARATDMDYYGRGDERYNSYAEGNRGYRPPSSQVSYGGNRSSGA
STPIYGMDYSNALPAGQRSREPYPAWTAEAQIPCTKEEIEDIFLDLTAKFGFQRDSMRNM
YDHFMTLLDSRASRMSPNQALLSLHADYIGGENANYRRWYFAAHLDLDDAVGFANMNLGK
ASRRTRKARKAAKKKASENPGNEQETLDAYEGDNSLEAAEYRWKTRMNRMSQHDRVRQVA
LYLLCWGEANQVRFMPELMCFIFKCADDWLNSPAGQAQTEPIEEFTYLNQVITPLYQYCR
DQGYEIQDGKYVRRERDHAAIIGYDDMNQLFWYPEGLERIVFEDKSRLVDIPPAERYLKL
KDVLWKKVFFKTYYERRSWFHMVINFNRIWVIHLTSFWFYTAYNSQPLYTKNYQQQLDQK
PEKAATLSAVALGGTIAAFIQIFATICEWCYVPRRWAGAQHLTKRLLFLIAVFVVNIAPS
VYIFGLDKRTGTIANVLGGVQFAIALVTFIFFSLMPIGGLFGSYLTRNSRKYVASQTFTA
SYPRLNGNDKWMSYGLWVLVFAAKLAESYFFLTLSIKDPIRILSHMKKPDCLGDAIIGNI
LCKYQPRILLGLMYFMDLILFFLDSYLWYIIANMLFSVSRSFYLGVSIWTPWRNIFSRLP
KRIYSKVLATTDMEIKYKPKVLISQIWNAVVISMYREHLLAIDHVQKLLYHQVPSEQEGK
RTLRAPTFFVSQEDHSFKTEFFPAQSEAERRISFFAQSLSTPIPEPLPVDNMPTFTVLIP
HYGEKILLSLREIIREDEPYSRVTLLEYLKQLHPHEWDCFVKDTKILADETSQFNGDDEK
GEKDTAKSKIDDLPFYCIGFKSAAPEYTLRTRIWASLRSQTLYRTISGFMNYSRAIKLLY
RVENPEVVQMFGGNSDKLERELERMARRKYKICVSMQRYAKFNTEERENTEFLLRAYPDL
QIAYLDEEPPENEGEEPRIYSALIDGHSEIMDNGMRRPKFRIQLSGNPILGDGKSDNQNH
SIIFYRGEYIQLIDANQDNYLEECLKIRSVLAEFEEMTTDNVSPYTPGLPSTKFNPVAIL
GAREYIFSENIGILGDIAAGKEQTFGTMFARTLAQIGGKLHYGHPDFLNGIFMTTRGGVS
KAQKGLHLNEDIYAGMNALLRGGRIKHCEYYQCGKGRDLGFGSVLNFTTKIGTGMGEQML
SREYYYMGTQLPLDRFLSFYYAHPGFHINNMFIMLSVQCFMFVLLNLGALNHETILCQFN
KDIPITDPQWPNGCANLVPVFDWVSRCIVSIFIVFFISFVPLVVQELTERGFWRAATRLA
KHFSSGSPFFEVFVTQIYSNALHTNLSYGGARYIGTGRGFATARIPFGILFSRFAGPSIY
IGARSLMMLLFATITVWGPWLIYFWASLMSLCLAPFLFNPHQFSWDDFFIDYREYLRWLS
RGNTRSHSASWIGYCRLSRTRITGFKRKILGDPSAKLSGDVPRAHFTNIFMSEILGPLVL
VAITLIPFLFINAQTGVNDNRHKDDDTATGDPKKSGALVRIAIIAFGPVAINAGVLGGMF
ALACCAGPLLSMCCKKFGAVLAAIAHAIAVLVLLIFFVVLMFLEGFSFPRALSGMIAVVA
IQRFVFKLIITLALTREFKADTANIAWWTGKWYTMGWHTISQPGREFLCKITELGFFAAD
FILGHVLLFFMLPILLIPYADKGHSMMLFWLRPSRQIRPPIYSLKQTKLRKRRVVRYAIL
YFVLLVVFLALIVGPIVAGKYIKLSVTLPMEILQPTGFSNNDTTNTPTGKCVDERPCPVW
NPAVDATGGGGAAASTDDAARRFRRYMAY

Enzyme Prediction     

EC	2.4.1.34:56

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT48	861	1640	0	0.9905277401894452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396784	Glucan_synthase	0.0	861	1690	1	819	1,3-beta-glucan synthase component. This family consists of various 1,3-beta-glucan synthase components including Gls1, Gls2 and Gls3 from yeast. 1,3-beta-glucan synthase EC:2.4.1.34 also known as callose synthase catalyzes the formation of a beta-1,3-glucan polymer that is a major component of the fungal cell wall. The reaction catalyzed is:- UDP-glucose + {(1,3)-beta-D-glucosyl}(N) <=> UDP + {(1,3)-beta-D-glucosyl}(N+1).
405046	FKS1_dom1	5.45e-47	354	463	1	111	1,3-beta-glucan synthase subunit FKS1, domain-1. The FKS1_dom1 domain is likely to be the 'Class I' region just N-terminal to the first set of transmembrane helices that is involved in 1,3-beta-glucan synthesis itself. This family is found on proteins with family Glucan_synthase, pfam02364.
367362	Glutenin_hmw	0.002	47	205	271	417	High molecular weight glutenin subunit. Members of this family include high molecular weight subunits of glutenin. This group of gluten proteins is thought to be largely responsible for the elastic properties of gluten, and hence, doughs. Indeed, glutenin high molecular weight subunits are classified as elastomeric proteins, because the glutenin network can withstand significant deformations without breaking, and return to the original conformation when the stress is removed. Elastomeric proteins differ considerably in amino acid sequence, but they are all polymers whose subunits consist of elastomeric domains, composed of repeated motifs, and non-elastic domains that mediate cross-linking between the subunits. The elastomeric domain motifs are all rich in glycine residues in addition to other hydrophobic residues. High molecular weight glutenin subunits have an extensive central elastomeric domain, flanked by two terminal non-elastic domains that form disulphide cross-links. The central elastomeric domain is characterized by the following three repeated motifs: PGQGQQ, GYYPTS[P/L]QQ, GQQ. It possesses overlapping beta-turns within and between the repeated motifs, and assumes a regular helical secondary structure with a diameter of approx. 1.9 nm and a pitch of approx. 1.5 nm.
367362	Glutenin_hmw	0.004	2	202	290	469	High molecular weight glutenin subunit. Members of this family include high molecular weight subunits of glutenin. This group of gluten proteins is thought to be largely responsible for the elastic properties of gluten, and hence, doughs. Indeed, glutenin high molecular weight subunits are classified as elastomeric proteins, because the glutenin network can withstand significant deformations without breaking, and return to the original conformation when the stress is removed. Elastomeric proteins differ considerably in amino acid sequence, but they are all polymers whose subunits consist of elastomeric domains, composed of repeated motifs, and non-elastic domains that mediate cross-linking between the subunits. The elastomeric domain motifs are all rich in glycine residues in addition to other hydrophobic residues. High molecular weight glutenin subunits have an extensive central elastomeric domain, flanked by two terminal non-elastic domains that form disulphide cross-links. The central elastomeric domain is characterized by the following three repeated motifs: PGQGQQ, GYYPTS[P/L]QQ, GQQ. It possesses overlapping beta-turns within and between the repeated motifs, and assumes a regular helical secondary structure with a diameter of approx. 1.9 nm and a pitch of approx. 1.5 nm.
367362	Glutenin_hmw	0.007	35	205	178	342	High molecular weight glutenin subunit. Members of this family include high molecular weight subunits of glutenin. This group of gluten proteins is thought to be largely responsible for the elastic properties of gluten, and hence, doughs. Indeed, glutenin high molecular weight subunits are classified as elastomeric proteins, because the glutenin network can withstand significant deformations without breaking, and return to the original conformation when the stress is removed. Elastomeric proteins differ considerably in amino acid sequence, but they are all polymers whose subunits consist of elastomeric domains, composed of repeated motifs, and non-elastic domains that mediate cross-linking between the subunits. The elastomeric domain motifs are all rich in glycine residues in addition to other hydrophobic residues. High molecular weight glutenin subunits have an extensive central elastomeric domain, flanked by two terminal non-elastic domains that form disulphide cross-links. The central elastomeric domain is characterized by the following three repeated motifs: PGQGQQ, GYYPTS[P/L]QQ, GQQ. It possesses overlapping beta-turns within and between the repeated motifs, and assumes a regular helical secondary structure with a diameter of approx. 1.9 nm and a pitch of approx. 1.5 nm.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEL31281.1|GT48	AEL31281.1|GT48	0.0	1	1949	1	1951
CAE7209855.1|GT48	CAE7209855.1|GT48	0.0	1	1949	1	1942
CBX98352.1|GT48	CBX98352.1|GT48	0.0	1	1949	1	1947
QRD01344.1|GT48	QRD01344.1|GT48	0.0	1	1949	1	1950
ABL63820.1|GT48	ABL63820.1|GT48	0.0	1	1912	1	1891

PDB Hits     

OAG24208.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40989|FKS2_YEAST	sp|P40989|FKS2_YEAST	0.0	108	1903	83	1870	1,3-beta-glucan synthase component GSC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GSC2 PE=1 SV=2
sp|A2QLK4|FKS1_ASPNC	sp|A2QLK4|FKS1_ASPNC	0.0	55	1909	54	1878	1,3-beta-glucan synthase component FKS1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=fksA PE=3 SV=1
sp|Q04952|FKS3_YEAST	sp|Q04952|FKS3_YEAST	0.0	203	1908	15	1777	1,3-beta-glucan synthase component FKS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FKS3 PE=1 SV=1
sp|P38631|FKS1_YEAST	sp|P38631|FKS1_YEAST	0.0	111	1903	58	1851	1,3-beta-glucan synthase component FKS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FKS1 PE=1 SV=2
sp|O93927|FKS1_CRYNH	sp|O93927|FKS1_CRYNH	0.0	165	1877	104	1781	1,3-beta-glucan synthase component FKS1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=FKS1 PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000004

TMHMM  Annotations     

Start	End
506	523
544	566
586	606
613	635
674	696
728	750
1348	1370
1403	1425
1481	1503
1516	1538
1609	1631
1661	1683
1698	1720
1732	1754
1797	1819
1857	1879