CAZyme Information: OAG24121.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG24121.1
• CAZy Family: GT1
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
934		101424.94	6.5638

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441472:1399310-1402482(+)

Full Sequence      

MSKVENMDPVWDDLDRTMGQLFMMGFDGTSVTPHIRTLIEEHHVGCILLTAKNLKSAEDT
TQLIYELQKIAHDAGHPVPLAIGIDQENGGVNSLFDDIYIRQYPSNMGMAATGSTELAFE
VAKATAQEIAACGINWIFGPCLDVLTNARNQPLGVRTAGDDPQEVSAFGCAFMAGYKDAG
VVTLGKHFPSYGNLEFLGSTLDVPIITESLEQLSLSALIPFKKAIERGLDSMMVGGCAMS
SAGLNAMHACLSEQVVDELLRTDLKFDGVVVSECLEMDALSHNIGVGGGTVMAVNAGCDV
VLLCRSFSLQQEGLKGLKTGIETEMVSKERIFNSLRRVLAMKKKCTSWEKALNPPGINYL
EKLQPSHTALSTKAYNSSITVVRDKNRLLPLTNILESEEELLLLTPLVKPLAASAASRAI
SDAANGAAGHSPEPAVWDRSSSVMSGERVFRELGRSLARQRNGRLLHTSYTANGVRPVHE
NLINRASAIIVLTADANRNLYQHGFTKHVSMICNMQYTTGGERREKPLIVVAVSSPYDFA
IDTSIGTYICTYDFTETALNSLVRVLYGELTPSGTLPGTISKSQKLHPSKQHWLVEIFNE
ERDGNALDTLVAAVVESTAPSQRSEMASATSNSFILHHPEVEESHFVVRNSSTQALYGFC
STYFFKATGTGVIGALFVDPARRKLSIGHSLHNRAIRTLLQKEGIKRFQLGSRLPSMYLG
IPTGHGNERKRLRSWFAQLGWGAALSRPVCNMVARNLQTWTPPTGMAKSLASAGAQFDLV
YGWDYAGPILDHIKTSNRQGLAEVYKLALTDPTACGIIRAKRPEDGALVGTVVLYNSHSR
LAEYIPPLKHLNEAAGGISSPVISPGVGEYSTLLQGLILLGMRQIKQLGCNACLLDYMDG
DGNFDGFSAMGFDVMHNFEEVSCDAATWTMIPPA

Enzyme Prediction     

No EC number prediction in OAG24121.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	78	302	9.5e-52	0.9537037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	3.65e-67	19	392	8	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	3.62e-61	14	339	2	314	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	1.22e-31	18	304	1	280	beta-hexosaminidase; Provisional
185053	PRK15098	3.07e-10	14	342	47	353	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7213699.1|GH3	0.0	1	934	1	934
QRC92437.1|GH3	0.0	1	934	1	933
CBX99837.1|GH3	0.0	1	934	1	886
UJO20030.1|GH3	0.0	8	934	9	932
SMR47486.1|GH3	0.0	7	933	16	942

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	2.34e-85	12	741	7	679	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	3.37e-63	14	581	13	532	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.41e-38	14	390	44	446	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.93e-38	14	390	18	420	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	2.66e-38	14	390	48	450	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	7.23e-38	14	390	44	446	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	6.55e-33	15	392	29	399	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|P48823|HEXA_PSEO7	5.18e-30	29	384	49	419	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q3SKU2|NAGZ_THIDA	6.29e-29	17	317	2	296	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
sp|Q82SJ8|NAGZ_NITEU	6.30e-27	23	317	7	296	Beta-hexosaminidase OS=Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) OX=228410 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OAG24121.1.