CAZyme Information: OAG24009.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG24009.1
• CAZy Family: GH93
• CAZyme Description: Carboxylic ester hydrolase [Source:UniProtKB/TrEMBL;Acc:A0A177DZ01]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256		27210.92	8.2063

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441472:1122581-1123412(-)

Full Sequence      

MNIYVPAKLATKPAIILALHYCGGTGEAYAQSTKYNSLAEQKGFINIFPSTKKDNNCWEV
NTAKGLSRDAGGDNQGLNNMIQYTIKKYGADPAKVFVTGSSSGCMMTNVMMATYPDVIAA
GSCYSGVAAGCVAGSPGASPSTADPRCANGQVIKTQAEWVAQVKAMYPGYTGTYPRMATW
HGTADTLVKIPNLGEQLKEWSGLLGVSFTKNVTNTPQSGYTQMVYGDGTKLVGYSALNVG
HTVPVHEAEDMKWFGL

Enzyme Prediction     

No EC number prediction in OAG24009.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	1	186	1.4e-21	0.73568281938326

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	4.26e-37	1	215	1	209	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	1.07e-24	3	244	51	277	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	1.41e-18	3	203	5	201	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
224423	DAP2	0.006	86	127	465	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7030940.1|CE1	6.61e-148	1	254	39	292
UQC91056.1|CE1	3.61e-128	1	256	36	292
QKD62144.1|CE1	5.38e-117	1	256	41	296
CCT72967.1|CE1	8.84e-116	1	256	41	296
QGI85778.1|CE1	8.84e-116	1	256	41	296

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	1.23e-79	1	255	19	273	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8M9H9|FAEB_TALSN	8.43e-91	1	256	36	291	Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) OX=441959 GN=faeB PE=1 SV=1
sp|Q9HE18|FAEB_TALFU	1.34e-88	1	256	36	291	Feruloyl esterase B OS=Talaromyces funiculosus OX=28572 GN=FAEB PE=1 SV=1
sp|Q9HGR3|FAEB_NEUCR	1.03e-86	1	256	36	290	Feruloyl esterase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=fae-1 PE=2 SV=2
sp|A1DBP9|AXE1_NEOFI	1.19e-79	1	255	49	303	Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=axeA PE=3 SV=1
sp|A2QZI3|AXE1_ASPNC	1.08e-78	1	255	47	301	Probable acetylxylan esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.663882	0.336104

TMHMM  Annotations     

There is no transmembrane helices in OAG24009.1.