CAZyme Information: OAG23915.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG23915.1
• CAZy Family: GH92
• CAZyme Description: trehalose

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
679	KV441472|CGC15	76811.40	4.2764

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441472:895294-897381(-)

Full Sequence      

MASMRSLIPALIASVPLANALFINGSVIAPCDSPIYCYGDLLREIELARPFEDSKTFVDL
PTTRPLEEVLAAFANLSRPIENNTALNDFLSEYFGEAGSELEEVPTDELETQPDFLDNVN
SSVVRDFTRQVIDIWPDLTRRYVGAGNCSGCVNSFLPVNRTFVVAGGRFREPYYWDSFWI
IEGLLRTQGSFTQIAENIIENFMDLVEDIGFVPNGARRYYENRSQPPLLTQMVRVYVEYT
QNYTLLERAIPILEKEYEFWVNNRTVTLERAGMNYSLNHYAVSNTQPRPESYYEDYVTAN
NATYFNEEGEEFNATQPLNETQKATLYSNLASGAESGWDYSARWIANPSDAVTETFFPLR
SLNTIEIIPVELNSILYYNEITIAEFHRHQGNYTAAREWAGRAANRSEAMTTVLWSPEHY
SYFDYNLTSSSQNIYTLADNTSTPLALQGAPPGKQIWFQISQFYPFWTGAAPESIKNDPK
AIRRVYARVEELLESRDGAIAATNLQTGQQWDEPNVWPPLQYILMQGLLNTPLEVSEDDD
EQSTEDYIWTQDLSLRIAQRYLDSLYCTWRVTGGATDEVPQLPDSQGNGTIFEKYSDEST
NAAGGGGEYTVVEGFGWSNGVLIWAADQFGQRLTTPECGNITAANIGGGDAKRKRSAMEL
SKRDAQWIKKTKGTRKLRY

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	51	628	1.4e-160	0.9938900203665988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215307	PLN02567	9.28e-137	49	630	25	545	alpha,alpha-trehalase
395961	Trehalase	2.01e-130	51	630	3	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
224541	TreA	5.08e-84	33	623	53	546	Neutral trehalase [Carbohydrate transport and metabolism].
183936	treA	1.06e-80	7	630	20	537	alpha,alpha-trehalase TreA.
237326	treA	1.41e-74	33	621	43	528	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7173893.1|GH37	0.0	4	671	1	668
ADX41482.1|GH37	0.0	1	679	1	678
QRD06839.1|GH37	0.0	3	678	4	676
CBX90798.1|GH37	0.0	163	672	7	515
EAA35900.1|GH37	2.43e-300	8	670	10	672

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	5.14e-79	53	630	40	555	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	7.40e-78	53	630	40	555	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
5Z66_A	6.97e-65	33	628	46	538	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JG0_A	1.84e-60	34	643	10	514	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	1.22e-57	34	643	10	514	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	2.02e-120	21	638	39	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|A8J4S9|TREA_APIME	5.49e-107	22	637	32	576	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1
sp|P19813|TREA_RABIT	2.71e-99	30	635	27	555	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|O43280|TREA_HUMAN	8.58e-99	30	635	27	556	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|Q9JLT2|TREA_MOUSE	1.40e-98	30	635	24	553	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000318	0.999656	CS pos: 20-21. Pr: 0.9668

TMHMM  Annotations     

Start	End
7	29