CAZyme Information: OAG23889.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG23889.1
• CAZy Family: GH79
• CAZyme Description: cutinase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
237		24440.84	6.9001

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441472:840697-841466(+)

Full Sequence      

MKYLAILSFFTSLALTSPIAVAVPVTAPADEPQLITLEARQSSATSNELETGSSAACPRT
IFIFARGSTEAGNMGALVGPFTANALENAYGASNVWIQGVGGPYTAGIAENTLPAGTSQA
AIREAQRLFNLAASKCPNTPITAGGYSQGAAVMSNAIPGLSAAVQNQIKGVVLFGYTKNL
QNGGRIPNFPTSKTRIYCETGDLVCTGTLIITPAHLLYSDEAAVQAPIFLRAQIAAA

Enzyme Prediction     

EC	3.1.1.74:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	56	233	1.3e-42	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	1.04e-60	56	234	1	173	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAA03470.1|CE5|3.1.1.74	1.39e-124	41	234	13	206
CAE7174277.1|CE5	4.13e-107	1	237	1	237
AKH80819.1|CE5	4.63e-89	1	234	1	223
AAL38030.1|CE5|3.1.1.74	4.63e-89	1	234	1	223
UQC87492.1|CE5	5.12e-89	1	234	1	226

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DCN_A	4.64e-87	43	234	9	200	Glomerella cingulata apo cutinase [Colletotrichum gloeosporioides],3DD5_A Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_B Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_C Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_D Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_E Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_F Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_G Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DD5_H Glomerella cingulata E600-cutinase complex [Colletotrichum gloeosporioides],3DEA_A Glomerella cingulata PETFP-cutinase complex [Colletotrichum gloeosporioides],3DEA_B Glomerella cingulata PETFP-cutinase complex [Colletotrichum gloeosporioides]
4OYY_A	2.22e-76	41	236	1	194	Humicola insolens cutinase [Humicola insolens],4OYY_B Humicola insolens cutinase [Humicola insolens],4OYY_C Humicola insolens cutinase [Humicola insolens],4OYY_D Humicola insolens cutinase [Humicola insolens],4OYY_E Humicola insolens cutinase [Humicola insolens],4OYY_F Humicola insolens cutinase [Humicola insolens],4OYY_G Humicola insolens cutinase [Humicola insolens],4OYY_H Humicola insolens cutinase [Humicola insolens],4OYY_I Humicola insolens cutinase [Humicola insolens],4OYY_J Humicola insolens cutinase [Humicola insolens],4OYY_K Humicola insolens cutinase [Humicola insolens],4OYY_L Humicola insolens cutinase [Humicola insolens]
7CY3_A	7.55e-75	44	234	4	193	Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY3_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9. [Paraphoma sp. B47-9],7CY9_A Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9],7CY9_B Crystal structure of a biodegradable plastic-degrading cutinase from Paraphoma sp. B47-9 solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). [Paraphoma sp. B47-9]
4OYL_A	2.96e-74	41	236	1	194	Humicola insolens cutinase in complex with mono-ethylphosphate [Humicola insolens],4OYL_B Humicola insolens cutinase in complex with mono-ethylphosphate [Humicola insolens],4OYL_C Humicola insolens cutinase in complex with mono-ethylphosphate [Humicola insolens]
1XZG_A	1.62e-68	24	230	2	203	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P41744|CUTI_ALTBR	2.47e-125	41	234	13	206	Cutinase OS=Alternaria brassicicola OX=29001 GN=CUTAB1 PE=2 SV=1
sp|P11373|CUTI1_COLGL	7.11e-91	1	234	1	223	Cutinase 1 OS=Colletotrichum gloeosporioides OX=474922 GN=CUTA PE=1 SV=1
sp|P10951|CUTI_COLTU	3.18e-83	1	234	1	227	Cutinase OS=Colletotrichum truncatum OX=5467 GN=CUTA PE=1 SV=1
sp|P30272|CUTI1_MAGO7	4.93e-75	1	237	1	228	Cutinase CUT1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CUT1 PE=3 SV=3
sp|P29292|CUTI_DIDRA	2.76e-73	36	236	24	223	Cutinase OS=Didymella rabiei OX=5454 GN=CUT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000268	0.999700	CS pos: 22-23. Pr: 0.9747

TMHMM  Annotations     

There is no transmembrane helices in OAG23889.1.