CAZyme Information: OAG23701.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG23701.1
• CAZy Family: GH78
• CAZyme Description: alcohol oxidase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
610		66744.17	5.3993

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441472:380201-382085(-)

Full Sequence      

MGIYNKLADDIDEVDIIIAGGGTAGCIIAGRLAEDDPSLSILVIEGGANNKDVASVVNPV
FYLQNLLPTTKTALFYKGNKSKQLADREPIVPSGGTLGGGSSINFMMYTRAQRSDFDSWN
TPGWSAEEMWPHLKKLETYHGPGAKEHHGHSGPIHVSDGGYRAKAAEDDFISAAEKVGYS
EIDDLQNLDNNNGIARWQRYVSPEGKRQDTAHTYLHPKLEDERYSNLHVLVESKVVRVVF
DDNKRATGVEYTPNPEFQATIGLSMHPVKQVRARKLVVVTCGACGTPPVLERSGVGAKEV
LERAGVPLVEELPGVGKDYQDHHLLLYPYKTALAPDQTIDGILSGRVDVAEMMKNKDPML
GWNGIDISSKLRPTEDEVTSLGPEFQEAWKRDFKDAPNRPLMLCGLVSCFLGDPASIPAG
QYVTAGNYTAYPYSRGHMHITGPKHDDALDFDVGFFNDKDDIDLKKQIWAYKKQREILRR
TKFYRGELAAGHPKFASDSAVAIQEDVSGPLEDVKDLVYSKEDDAAIEQWLRENVNTTWH
SLGTCKMAPREKDGVVDGSLNVHGVKGLKIADLSIPPENVGGNTNNTALVIGEKAADIII
AELRGGAGTP

Enzyme Prediction     

EC	1.1.3.13:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	12	603	1.7e-281	0.9966101694915255

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	7.59e-67	20	602	14	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.23e-62	20	599	12	531	choline dehydrogenase; Validated
274888	Rv0697	3.25e-43	20	599	7	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	4.27e-32	432	595	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	3.63e-30	103	322	33	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBX90875.1|AA3_3	0.0	1	610	1	610
CAE7174359.1|AA3_3	0.0	1	610	1	612
CEI62196.1|AA3_3	9.42e-310	1	603	1	602
QPC70859.1|AA3_3	1.58e-309	1	603	1	602
CZS81771.1|AA3_3	2.60e-308	1	603	1	602

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6H3G_A	1.63e-151	12	603	5	624	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3G_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
6H3O_A	2.59e-150	12	603	5	624	Chain A, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_B Chain B, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_C Chain C, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_D Chain D, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_E Chain E, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_F Chain F, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_G Chain G, Alcohol oxidase [Phanerodontia chrysosporium],6H3O_H Chain H, Alcohol oxidase [Phanerodontia chrysosporium]
5HSA_A	1.21e-132	12	603	5	636	Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_B Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_C Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_D Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_E Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_F Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_G Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5HSA_H Alcohol Oxidase AOX1 from Pichia Pastoris [Komagataella phaffii CBS 7435],5I68_A Chain A, Alcohol oxidase 1 [Komagataella pastoris]
6YS1_AAA	1.84e-44	13	607	7	568	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	2.51e-44	13	607	7	568	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00922|ALOX_CANBO	1.70e-144	12	609	5	641	Alcohol oxidase OS=Candida boidinii OX=5477 GN=AOD1 PE=1 SV=1
sp|P04841|ALOX_PICAN	2.47e-144	12	603	5	637	Alcohol oxidase OS=Pichia angusta OX=870730 GN=MOX PE=1 SV=1
sp|F2QY27|ALOX1_KOMPC	6.22e-132	12	603	5	636	Alcohol oxidase 1 OS=Komagataella phaffii (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) OX=981350 GN=AOX1 PE=1 SV=1
sp|P04842|ALOX1_KOMPG	6.22e-132	12	603	5	636	Alcohol oxidase 1 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX1 PE=1 SV=2
sp|C4R702|ALOX2_KOMPG	4.89e-131	12	603	5	636	Alcohol oxidase 2 OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=AOX2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000034	0.000019

TMHMM  Annotations     

There is no transmembrane helices in OAG23701.1.