CAZyme Information: OAG23499.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG23499.1
• CAZy Family: GH76
• CAZyme Description: glycoside hydrolase family 3 domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
866		94143.03	4.4584

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441473:1432722-1435322(-)

Full Sequence      

MYVSTTVWTGLLYTLTRVHASSQTLAYRPWLDPTVPNEQRLQLFLDQLNSTQKYAMVQGD
TELDENGTGVNPCIGHISGNETLGVPSICMGDGPAGVGNNLNNVTAFPAPIAAAASWNTS
LEYAYGQALAQEHMAKGRNVVLSPTINILRSPLWARAAETFSEDPWLTSRMAVAGVMGVQ
NQGALACPKHLAGYNQDTNRFGVGPTWDTVDVHIDKRVLHELYLPAFKASVQEADAASVM
CSYNMLNGFFACENDWLLNTTLRQEWGFQGFVVADWYFSTRSTVGAVMAGLDISMPGGSL
ETSYGFPAYYGDLLVEAVNNGTIPASRIDDMVARTWRYMFKLGMVDNPVTGNAESVARTQ
AHIDLAQKMAEDGSVLLKNDDQTLPLSPQKYTHVAVYGVDGTNQSQVTENHGGFVIDTTM
VVQSPLGALKQRASKEGNMTVTYAEAYPGTGEFPTVPSSMFVDDGLNVTYYTTTDFSGPI
NQIDFVPNITSASFPKELWVSWPQVFSCVYEGTFKANTSGMYHFSLTGQGDAVLYIDGQV
IANMSKANFGNTIQGIANLTAGEEVSLSLNYSMGYSLSTGAYGVTLGVDVGNKARDQEAM
SLAEKADLSIVFASDRHSEGVDSNIGLSLPGDQDAVISRIAKRSKKTVVILNTNSAILMP
WIDEVDAVMQSWYGGQQIGLALERLLFGDVSPSGKLPVTFPKTLDDAIKITSDLNVPYEE
GLNVGYRWFDEHKIDPLFSFGHGLTYSTFELEGLAMHLANSTVTSSSEFVICSTTLTNTG
AVAASEVVQLYVSYPEAAREPPKLLKGFAKVYLEVGQSTEVPLQVLKDDLKIWSEQKDGW
EFVHGEYSFLVGFSASDIKVEGKMIL

Enzyme Prediction     

No EC number prediction in OAG23499.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	79	296	1.1e-63	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.13e-68	116	859	129	758	beta-glucosidase BglX.
224389	BglX	6.47e-57	116	416	92	380	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	1.60e-41	116	825	123	742	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	4.41e-38	83	334	64	312	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	1.92e-37	575	726	60	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC81645.1|GH3	0.0	26	859	18	843
QKX54115.1|GH3	0.0	11	866	10	859
UAY75117.1|GH3	1.15e-217	28	858	29	848
AXB78682.1|GH3	8.07e-213	28	860	48	871
AOR79733.1|GH3	2.53e-210	26	860	11	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4I3G_A	9.11e-113	74	859	81	821	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
7MS2_A	1.34e-89	81	861	33	663	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
6JXG_A	8.85e-86	45	864	17	710	Crystasl Structure of Beta-glucosidase D2-BGL from Chaetomella Raphigera [Chaetomella raphigera]
3AC0_A	1.61e-80	81	858	34	828	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
5WAB_A	1.33e-78	76	858	28	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P27034|BGLS_RHIRD	3.44e-102	81	859	30	803	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	1.46e-100	76	858	29	822	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q5BFG8|BGLB_EMENI	1.72e-99	84	861	42	835	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|Q5BB53|BGLI_EMENI	5.66e-99	76	847	29	812	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
sp|Q2U8Y5|BGLI_ASPOR	2.13e-97	76	861	29	831	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.760354	0.239675

TMHMM  Annotations     

There is no transmembrane helices in OAG23499.1.