CAZyme Information: OAG23435.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG23435.1
• CAZy Family: GH76
• CAZyme Description: alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
623		66655.65	5.9104

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441473:1257386-1259369(-)

Full Sequence      

MRVSVAAVSLLASLASANLDSPSLLQQFYAPGRLLGNSFGNPGVNATYDYVVVGAGLAGA
LTASRIAEALPNMTVAVIEAGSFYEISNGNYSQIPYYSTMYVGPDPEDYQPLIDWGIFTE
PIPGANGRRFHYAQGKTLGGSSARNQEIYHRATKGWYESIANITGDPAYLWDNMFPFMKK
SFSFTPPDARFRAENASNINFTLSAFDIPGGPVHLSFPKYAQPIASYGAEGYAAAGMNAA
NGFLDGNLLGYGYWPFTLKPEDSTRSSTESAFLSHTAARTSLKIYQSCMARNILFDESKR
ATAVNVTAGGMRPFIVHARKEVIVSSGLFHSPQLLMVSGIGPREALERYNITVISELNGV
GQNLRDTPAIGGVVHHTNVPGRSAWERESSSFDAAVERYLTNGSGPLSSPASDFAAWERM
PEQFTTNMSRSTLEFLRDLPSDWPNVEYVLQAAERILSSAQTASDTGVIGTILTSTTSAG
NVTIQSADNAVAPVVYIGWLDSLEDQELAVAAYRRARTIAASISAFGDEIAPGANVTTDA
QILHYIRTKGMGAIHHGAATCAMGRNASNGAVVDSKARVFGVSGLRVVDASSLPFNAPGH
TQGVTYAHAEKLAQDIINAVNDV

Enzyme Prediction     

No EC number prediction in OAG23435.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	47	618	2.4e-151	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	7.54e-69	47	617	5	531	choline dehydrogenase; Validated
225186	BetA	2.42e-67	44	616	4	533	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.19e-31	477	612	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.49e-18	125	369	14	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.51e-13	38	599	46	558	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7021697.1|AA3_2	0.0	13	623	13	622
QRC93166.1|AA3_2	8.45e-301	73	620	1	546
QIW99859.1|AA3_2	1.36e-184	10	617	5	602
QKX61393.1|AA3_2	2.53e-180	23	619	17	609
SMR60751.1|AA3_2	2.50e-163	85	617	29	557

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	4.23e-45	44	617	2	582	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
7AV4_AAA	9.76e-40	41	613	77	633	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	1.54e-39	41	613	1	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	2.09e-39	41	613	1	557	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	2.50e-39	41	613	17	573	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFL2|PATE_ASPCL	3.50e-138	15	619	13	627	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|Q0CJ60|ATC_ASPTN	6.59e-136	33	618	31	595	Cyclase atC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=atC PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	1.08e-133	33	616	38	624	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	6.61e-124	22	621	16	611	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|A0A1U8QYA8|CICC_EMENI	3.34e-117	35	617	23	608	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002762	0.997209	CS pos: 17-18. Pr: 0.9580

TMHMM  Annotations     

There is no transmembrane helices in OAG23435.1.