CAZyme Information: OAG23047.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG23047.1
• CAZy Family: GH67
• CAZyme Description: Beta-xylanase [Source:UniProtKB/TrEMBL;Acc:A0A177DU32]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398		44735.30	6.0471

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441473:330726-332062(+)

Full Sequence      

MLSKSGLAITTTVDTKHFTDTFTVTNDRETIFYHTFVRPDCILGYTVLPVAGNRRTGLIG
IRISFVSHLNSAPGLSDLAKKAGLKYFGTAVDNVVLDNDGYTSIAFKRSEFNQVTASNGQ
KWVHTEPQRDFFNYTLGDQIVDASKEADQIRRCHTFLWHNQLPTWLTTGTWTKASLLTVL
ENHIKNVAEYYWDDCYAWDVVNEAFNDDGTLRKTIWLDAIGPEYIEHAFRLARQYASPGT
KLYYNDYGIERVNNKSLAIARMIREYQGVGVPIDGVGLQAHFTVGRAPLYTDIRASQQLF
SSLGLETALTELDVRMTLPDNANKTAAQATIYADSVRACADEESCVGVTVWDFWDTVSWV
PETFIGEGNACLWNQNLQRKPAYYAVADVLRKAGEKRG

Enzyme Prediction     

No EC number prediction in OAG23047.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	76	388	6e-93	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	1.01e-127	75	388	1	310	Glycosyl hydrolase family 10.
214750	Glyco_10	2.45e-101	121	386	2	263	Glycosyl hydrolase family 10.
226217	XynA	6.30e-78	71	393	17	344	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD06358.1|GH10	6.15e-176	71	396	26	351
AGV40653.1|GH10	3.57e-158	73	391	30	350
QSZ37437.1|CBM1|GH10	3.60e-112	61	393	1	337
APA09395.1|CBM1|GH10	3.73e-110	69	393	12	337
CCD53493.2|CBM1|GH10	4.75e-109	75	393	19	337

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JDT_A	2.67e-100	74	383	2	310	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	5.50e-94	71	383	21	332	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3WUB_A	2.45e-91	75	390	5	312	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUF_A	3.46e-91	75	390	5	312	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3U7B_A	1.79e-83	71	392	1	326	A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_B A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_C A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_D A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_E A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ZNB1|XYND_TALFU	2.00e-99	75	386	21	330	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1
sp|O60206|XLNA_AGABI	1.12e-96	75	388	19	329	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1
sp|Q9HEZ1|XYNA_PHACH	9.45e-95	71	387	90	403	Endo-1,4-beta-xylanase A OS=Phanerodontia chrysosporium OX=2822231 GN=xynA PE=1 SV=1
sp|B7SIW2|XYNC_PHACH	3.26e-90	70	387	79	394	Endo-1,4-beta-xylanase C OS=Phanerodontia chrysosporium OX=2822231 GN=xynC PE=1 SV=1
sp|P79046|XYN1_HUMGT	3.99e-90	69	390	12	337	Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea OX=5528 GN=xyn1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999417	0.000600

TMHMM  Annotations     

There is no transmembrane helices in OAG23047.1.