CAZyme Information: OAG22854.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG22854.1
• CAZy Family: GH55
• CAZyme Description: cellobiose dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
883		93313.79	7.8226

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441474:1259156-1261910(+)

Full Sequence      

MKTTSFVRAASLLSSLFAPVALAQEKFTHEGTGIEFWRQVVSDSQTAGGFEWGWVLPGEP
TGANDEYIGYIKGSLEANRQGWSGVSHAGGMPNSLLLVAWPETDAVKTKFVWAGGYVAPE
DYTGNATLSQIFHSVTDTHFEIVYRCEHCWVWNQGGAEGSQLPTTEVNVIGWAQHDKIYD
GTWVFHNKGQSQFGAPTADARNAKYSDYVKLVGGQPSGAPTPTLSGQPSATPTPTAPVKC
VGSPAPSGSFDYIVIGGGAGGIPVADKLSESGKSVLMLEKGPPSLARFGGKMGPDWATSN
NLTRFDIPGLCNQIWVDSAGVACTDIDQMAGCVLGGGSAVNAALWWKPVDIDFDYQFPTG
WKSADVKGAIDRVFKRIPGTDTPSVDGKRYKQEGFDVLSGALGADGWKSVVANNQQNQKN
RTYSHSPFMYDNGQRQGPLGTYMVSALARKNFKLWTNTMARRIVRSGGAATGVELESGVG
GTGYCGTVNLNPGGRVIVSGGAFGSSKVLFRSGIGPKDQLNVVKNSALDGSTMIGESDWI
NLPVGQNLNDHVNTDLVIKHPNISFYDFYKAWDAPIEADKDLYLGKRSGILAQSAPNIGP
LAWEVITGSDGIDRSIQWTARVEGPGANDTHHLTISQYLGHGSTSRGTLSINGALNVYVS
KAPYLQNEADTGVVVAGIKSMMKAIKKNPAIEFQVPPENMTVEAYVASLPKTPAARRANH
WIGTAKIGTDSGLTGGTSVVDLNTQVYGTQNIHVVDASLFPGHIFTNPTSYIVVLAEHAA
AKILALGASSGGGKPSSSMQSSAASAKPTSSKAPIKSSTVSVKPSSTAKPTTIKTSTAPA
PTPTKVANAWEQCGGKGYTGPTSCVSGYKCAVNNDYFSQCIPN

Enzyme Prediction     

EC	1.1.99.18:13	1.1.99.18:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	236	786	2.5e-239	0.9872262773722628
AA8	27	208	1.1e-46	0.9945054945054945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406418	CDH-cyt	1.84e-53	27	204	1	177	Cytochrome domain of cellobiose dehydrogenase. CDH-cyt is the cytochrome domain, at the N-terminus, of cellobiose dehydrogenase. CDH-cyt folds as a beta sandwich with the topology of the antibody Fab V(H) domain and binds iron. The haem iron is ligated by Met83 and His181 in UniProtKB:Q01738.
225186	BetA	2.99e-40	245	785	3	535	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
187688	CDH_like_cytochrome	5.64e-29	27	195	2	166	Heme-binding cytochrome domain of fungal cellobiose dehydrogenases. Cellobiose dehydrogenase (CellobioseDH or CDH) is an extracellular fungal oxidoreductase that degrades both lignin and cellulose. Specifically, CDHs oxidize cellobiose, cellodextrins, and lactose to corresponding lactones, utilizing a variety of electron acceptors. Class-II CDHs are monomeric hemoflavoenzymes that are comprised of a b-type cytochrome domain linked to a large flavodehydrogenase domain. The cytochrome domain of CDH and related enzymes, which this model describes, folds as a beta sandwich and complexes a heme molecule. It is found at the N-terminus of this family of enzymes, and belongs to the DOMON domain superfamily, a ligand-interacting motif found in all three kingdoms of life.
235000	PRK02106	2.21e-22	432	784	196	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.59e-20	644	779	2	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7185711.1|AA3_1|AA8|CBM1	0.0	1	882	1	859
CBY00194.1|AA3_1|AA8	0.0	1	794	1	793
QRD05353.1|AA3_1|AA8|CBM1	0.0	1	883	1	860
ADT70774.1|AA3_1|AA8|CBM1|1.1.99.18	1.04e-309	1	881	1	837
AEO69014.1|AA3_1|AA8|CBM1|1.1.99.18	2.50e-275	1	881	1	830

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QI7_A	6.23e-268	23	881	3	806	Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A],4QI7_B Cellobiose dehydrogenase from Neurospora crassa, NcCDH [Neurospora crassa OR74A]
4QI6_A	7.36e-267	27	881	8	807	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
4QI4_A	9.74e-230	246	881	3	585	Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides],4QI5_A Chain A, Cellobiose dehydrogenase [Thermothelomyces myriococcoides]
1NAA_A	1.45e-117	250	786	3	537	Chain A, Cellobiose dehydrogenase [Phanerodontia chrysosporium],1NAA_B Chain B, Cellobiose dehydrogenase [Phanerodontia chrysosporium]
1KDG_A	1.68e-117	250	786	8	542	Chain A, cellobiose dehydrogenase [Phanerodontia chrysosporium],1KDG_B Chain B, cellobiose dehydrogenase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01738|CDH_PHACH	8.89e-141	11	786	5	769	Cellobiose dehydrogenase OS=Phanerodontia chrysosporium OX=2822231 GN=CDH-1 PE=1 SV=1
sp|A8JHB7|FAP_CHLRE	2.32e-18	246	781	40	594	Fatty acid photodecarboxylase, chloroplastic OS=Chlamydomonas reinhardtii OX=3055 GN=FAP PE=1 SV=1
sp|Q47944|SDH_GLUOY	1.56e-16	250	780	5	524	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|C3MIE4|BETA_SINFN	6.75e-16	251	784	4	526	Oxygen-dependent choline dehydrogenase OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=betA PE=3 SV=1
sp|A6X2G7|BETA_BRUA4	1.02e-13	251	784	4	526	Oxygen-dependent choline dehydrogenase OS=Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37) OX=439375 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000372	0.999626	CS pos: 23-24. Pr: 0.9738

TMHMM  Annotations     

There is no transmembrane helices in OAG22854.1.