CAZyme Information: OAG22743.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG22743.1
• CAZy Family: GH5
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411		47197.86	7.1212

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441474:1014070-1015424(-)

Full Sequence      

MRTRPRQPPPKLHLDIAMPPRSPIASHFSGKLTSQVRRVLPAYLALLFIFLFFANTHFFT
TPIRAASKYRRELKYQQPLQLNGAVIPRKIWQTWKVGPLGFEKRDSDSAKTWPAKNPQYR
YEVLTDDNANEYLEWHYGAHGINRPDLVDLYRELNITIIKADLLRYLVMYAEGGVYADID
VECLRPISRFIPERYNEQDVDMIIGVEIDEPTFADHEILGSKCKSFCQWTFAAKPRLPVM
MRLIENIQVWLHELSHEKEVEISQLHLDFDEVISGTGPSAFTKAVLEQMTAQNQGKPVTW
DLFHNLAESRLVNGILVLNVEAFAAGQGHSDSGNHDSRGALVKHHYHASGWPTLHPRRNH
PMYGEVEQCNWKPECVAEWDKNVAEWDTLPKEEQDKRIASKLPPPGGAKPH

Enzyme Prediction     

No EC number prediction in OAG22743.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	107	192	3.8e-21	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.42e-24	63	313	60	310	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.02e-13	104	193	3	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7015986.1|GT32	1.02e-251	18	378	1	361
CBX95845.1|GT32	4.14e-250	18	405	1	388
QRC90100.1|GT32	2.96e-244	18	401	1	384
QYS97060.1|GT32	5.28e-165	25	398	14	384
UKZ75513.1|GT32	1.31e-164	25	398	14	384

PDB Hits     

OAG22743.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.80e-34	84	351	140	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	5.08e-32	67	349	81	374	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	9.63e-29	61	317	108	355	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	1.70e-23	70	349	81	468	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	4.64e-09	51	188	29	150	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000017	0.000017

TMHMM  Annotations     

Start	End
39	61