CAZyme Information: OAG22444.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG22444.1
• CAZy Family: GH47
• CAZyme Description: rhamnogalacturonase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
442		47333.79	8.4521

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441474:324915-326538(+)

Full Sequence      

MHFSQFLLAAAAIAPAFGQLSGKVGPLTTHAAKTAKKTCNVMNYGAKADKSTDLGPALLK
AFTACKTGGTVIVPSGDYALKTWVTFEGGKAWALQLDGIIYRTGTEAGNMLFVRNANDFE
MFSSTGRGAIQGNGYQDHKNGKRNGARLLRIEKSNNFSVHDIILVDAPMFHFVINTCTNG
EAYNMAIRGGDWGGLDGVDVTGTNLWVHDIMVTNKDECVTVKSPSKNVLIENIYCNWSGG
CAMGSLGADTAISSIVYKNIYTWKSNQMMMVKSNGGSGYVEDVVFENFIGHGNAWSLDID
QKWASMSAIAGNGVQLSNMTFKNWKGTVEYGLNRGPVKVACADKAPCTDINIQDLAMWTE
KGNHNIYQCQNGYGSGFCLKKGTGPSYAATTSTQTAAPTGYSAPTMKENLKTAFGTASPI
PIPTMPASFYPNTPPITKLAGQ

Enzyme Prediction     

EC	3.2.1.171:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	63	371	2.3e-53	0.9569230769230769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215540	PLN03010	1.15e-26	40	371	48	388	polygalacturonase
165802	PLN02155	1.07e-22	34	374	23	380	polygalacturonase
177865	PLN02218	2.26e-20	35	350	64	401	polygalacturonase ADPG
395231	Glyco_hydro_28	8.79e-20	126	371	65	314	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
178580	PLN03003	5.25e-19	34	370	19	371	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7186140.1|GH28	5.36e-240	1	441	1	441
ABF50898.1|GH28|3.2.1.171	1.22e-207	1	441	1	440
BAE66335.1|GH28	2.76e-205	4	442	7	448
UDD65679.1|GH28	2.76e-205	4	442	7	448
CAK48512.1|GH28	4.80e-205	13	442	14	446

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	2.42e-204	19	441	1	422	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
4C2L_A	3.48e-16	46	288	23	289	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ARE6|RHGA_EMENI	2.16e-208	1	441	1	440	Rhamnogalacturonase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rhgA PE=2 SV=2
sp|B0Y0Q3|RHGB_ASPFC	4.09e-207	7	442	8	446	Probable rhamnogalacturonase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=rhgB PE=3 SV=1
sp|Q2TWN8|RHGB_ASPOR	4.90e-206	4	442	7	448	Probable rhamnogalacturonase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rhgB PE=3 SV=1
sp|Q4WV23|RHGB_ASPFU	6.71e-206	7	442	8	446	Probable rhamnogalacturonase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=rhgB PE=3 SV=1
sp|A2R3G4|RHGB_ASPNC	8.53e-206	13	442	14	446	Probable rhamnogalacturonase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000258	0.999681	CS pos: 18-19. Pr: 0.9762

TMHMM  Annotations     

There is no transmembrane helices in OAG22444.1.