CAZyme Information: OAG22360.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG22360.1
• CAZy Family: PL1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	KV441474|CGC8	41528.82	5.0392

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441474:104313-105627(+)

Full Sequence      

MSTKVKCIVLSSFASLISTFNTLSHEQISLILPQANSTLGFGAILALSHPSSPRRQSLLW
AANLTDIEIVVPEQKEWEVDDVERLKVKESSLSPGSAKAWLGHLEVLKWFLASDYETALI
IEDDTDFDISIRSSQIPLLAPAFRSLLNSTGDDHTSYWAPTTSWDLLYPGHCDDLISTAY
LSQPFFLYNDPTTPFHTVLHPDTALFLSSLSVPSETRILHRSYWPFCTFAYAVNRRSAAL
ILSTFSKEPAGGISAYDVALLSACRDRDWKCWSVAPELFHHGLGDSEIFKADKAEEGKGE
ERESKGSARGTWNLGCGARHRQLWVDEADGEMRNLIKDLVRSAVRRGQCLIDKVMEEETW
KGCEHDECGAQS

Enzyme Prediction     

No EC number prediction in OAG22360.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133474	Glyco_transf_25	8.12e-04	44	128	2	96	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7186744.1|GT25	1.08e-154	32	372	50	390
QRD05404.1|GT25	6.98e-121	24	372	60	401
QDS68839.1|GT25	1.53e-70	35	329	58	366
CAE7032731.1|GT25	1.63e-63	35	350	49	418
QRD04770.1|GT25	4.78e-62	35	358	49	429

PDB Hits     

OAG22360.1 has no PDB hit.

Swiss-Prot Hits     

OAG22360.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.972959	0.027040

TMHMM  Annotations     

There is no transmembrane helices in OAG22360.1.