CAZyme Information: OAG22209.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG22209.1
• CAZy Family: GH43|CBM91
• CAZyme Description: alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
618		67494.96	5.0676

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441475:902102-904027(+)

Full Sequence      

MVQHTGCVTSIDALSTQEPDFIVIGGGIGGLVVANRLSEDAEKKVLLIEAGANRRGDPKI
DTVGMLSTLYGDPDYDWDFMTEPQMHVNGRQIPHPRGKVLGGSSAINFGATVYPSKADFE
SWEALGNEGWGATGVAPYLRKFSRFTAPSAETKELLSIDYINEELHGKDGPVPVTIPDVY
GPFQASWVKTLDNLGWCNSDDPIEGEKLGTFACGLSIDAETKTRGYAASAYYTQQVAERP
NLEVLTETFVEKILTNVCDGSVQAIGVKIRTRSGVHEITAKKEVILSAGTIQSPQVLELS
GIGQKELLEKHGIPVVLDSPGVGENLQDHAISAPCFEIADDQFSADIMRDPNIVQAVLQQ
YMSTKTGPLVGIPISVTMLPLIDSDGRVSHDEIAQMARQCGEDKDLPLWQKRQYEQLEKQ
ISGPNEAAGYAMMLPLQLNISAGATQMKELLAPSNPKNFITIMAVNNHPFSRGFCHIRSA
DPKEKPILDPKYLSHPLDLEILARYTQYIETIVKTEPFASLLKPSGRLPDGKRATDLDAA
KDIVKERLLSTFHPTGTCAMMPKELNGVVDSRLKVHGTKNLRIVDASIFPMETLGNIQAT
VYAVAEKAADLIKQDWKK

Enzyme Prediction     

No EC number prediction in OAG22209.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	20	615	1.5e-179	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.20e-99	34	613	21	532	choline dehydrogenase; Validated
225186	BetA	8.31e-99	34	615	23	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	1.03e-45	34	612	16	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	9.55e-41	469	608	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	8.91e-30	87	329	14	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAQ25461.1|AA3_2	0.0	1	616	1	610
CAK96255.1|AA3_2	1.16e-249	20	613	8	606
BCR96633.1|AA3_2	2.52e-246	20	613	8	606
UDD56791.1|AA3_2	3.19e-233	13	613	2	607
QMW28733.1|AA3_2	2.59e-232	13	613	2	607

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	5.86e-79	21	615	8	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4YNT_A	9.46e-78	14	617	1	569	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
5OC1_A	2.13e-67	20	615	3	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.14e-66	20	615	4	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5ZU3_A	1.45e-64	20	617	8	574	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	6.69e-107	9	615	4	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A161CEV4|CITC_MONRU	6.79e-103	8	615	4	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	6.79e-103	8	615	4	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	3.14e-90	13	615	34	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	3.76e-85	14	612	42	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999911	0.000149

TMHMM  Annotations     

There is no transmembrane helices in OAG22209.1.