CAZyme Information: OAG21584.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG21584.1
• CAZy Family: GH35
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:A0A177DNP6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
897		98737.15	4.7805

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441476:486501-489610(-)

Full Sequence      

MATINIGNASPTEDIRQYDIKHAAIHIQPVTLDTPTLTPAATPEDASPAEETMAGKKIYS
MERPDDRARQLAAKLTLEEQISLLAGADFWRTVAIPEKGIPSIKTSDGPNGARGEFFTNG
TPAALFPCGISMASTWNVDMIEEIGRHLGEESKARGAHVLLAPTVCMHRSPLGGRNFESY
SEDPFLTGKLAASYVRGLQSKGVAATIKHFLGNEQETERQAYDAIIAERPLREIYLKPFE
IAVRDASPWALMSAYNMINGVHADEYEHSIKEVLRGEWKWNGAIISDWTGTYATAPSIRA
GVDIEMPGPSKWRKVEQVKECLENGELTRGDIEESAARVLYLVDRVKGLNNMTPEEPEQS
IDNVETRNLILQAGIEGLTLLKNENNVLPIKNAKKIAMIGPNVKRAIASGGGSAGLNPYY
NVTPWQGLQNRFDGDITFAQGCDSSKWLPLASPYCQSNGETGVQLEYYKGDRFSGEPAVI
QHKVSTDLWLWDSAPMELLPDFSFKVKTTLTPKSTGNHSFSFASVGPGRMFINGDIFIDN
WDWTQEGEAMFSASEDVLKSIHLEAGKSVEILIESTNEVRPASKVSVIGRRHDYGGCRIG
YQEEDKIDRLQEAADAARDADVAVVVVGLDAEWESEGYDRQTMDLPKNGSQDRLIEAVLA
ANPRTVVVNQSGTPITMPWVQKAPAILQAWYQGQEAGNALADVLLGNSSPSGKLPTTFPV
RIEDNPAYHNWPGENLKTVYGEGIYVGYRHYERSKIAPLFAFGHGLTYTTFEYKTPRASD
TVLQEDGEIIITVPVTNSGSVAAHEIVQAYVKDVKSTLPRPEKELQAFGKVFLQPGETKD
VILTLNKYSVGYFDTSLGQTGAWIAEEGEFEVLIGASSADIRSKLNFEVKESFQWIF

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	94	307	4.8e-66	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.31e-83	126	883	120	759	beta-glucosidase BglX.
224389	BglX	6.75e-66	88	415	48	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	4.60e-50	378	748	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.47e-42	99	342	65	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.81e-34	67	846	52	743	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7001702.1|GH3	0.0	1	897	1	898
QRC98638.1|GH3	0.0	1	897	1	895
QDS68320.1|GH3	0.0	81	882	39	837
AEO66128.1|GH3	0.0	68	897	59	888
APA09558.1|GH3	0.0	59	897	47	887

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.29e-202	70	895	8	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.82e-198	70	895	8	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.01e-150	69	892	6	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	2.77e-118	66	891	2	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	4.09e-117	66	891	2	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y3M6|BGLI_ASPFC	1.65e-224	74	896	12	836	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q5BFG8|BGLB_EMENI	2.92e-224	73	885	16	834	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|Q4WU49|BGLI_ASPFU	6.58e-224	74	896	12	836	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	6.11e-222	74	896	12	837	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	3.34e-221	74	896	12	836	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000001

TMHMM  Annotations     

There is no transmembrane helices in OAG21584.1.