CAZyme Information: OAG21409.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG21409.1
• CAZy Family: GH31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342		39320.84	7.4732

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441476:58350-59441(-)

Full Sequence      

MFVRQLVVRVIAAAVLLKIVSVIWHQYVFQSFLVEQQITFGDFPTDYAKKLNESRANNQQ
PQESDYSSTYNGTKIARTIHYIWFERIYPGHEGPSGGPSIGFGSPQLCREHNPSYEIRMW
NATSAREFLSNEYAWFLPTYDNYKYPIQKVDALKYFALYHFGGVYMDLDVACRRSLDPLL
DFPAWFPEASPLGVNNDLMASAAKHPIVKRMTEGLVTHNWNLLFPYLTIFWTTGPQFTST
ILQEWFEECPDGKCMQRGARDDLDSDSFVVLPRVFYSEEYTFFGHKPGGSWHGGDVAVVL
WFVERPWAIASVATAFVGTIFGIIRLRSRRARQRGKAYIPLV

Enzyme Prediction     

No EC number prediction in OAG21409.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	108	180	4.3e-20	0.8555555555555555

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	5.92e-45	46	309	54	297	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.42e-21	108	181	11	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD05528.1|GT32	1.99e-136	9	330	9	332
CBX91546.1|GT32	5.04e-113	26	246	26	247
SMR63753.1|GT32	1.91e-105	29	301	35	307
SMY29113.1|GT32	1.54e-104	29	301	35	307
SMR60642.1|GT32	5.61e-92	29	333	35	319

PDB Hits     

OAG21409.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	7.47e-49	75	336	57	303	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P33300|SUR1_YEAST	9.36e-44	106	321	77	279	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	6.39e-42	75	313	82	302	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	7.66e-40	65	337	54	308	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P38287|CSH1_YEAST	2.65e-39	106	295	84	263	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996713	0.003327

TMHMM  Annotations     

Start	End
7	29
307	326