CAZyme Information: OAG21367.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG21367.1
• CAZy Family: GH31
• CAZyme Description: cellobiohydrolase-like protein II precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395	KV441477|CGC1	41932.15	4.8612

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441477:1067011-1068355(-)

Full Sequence      

MKGLFSFAVASVITGAFALPSPTENGPITARQAAACATPVTLSGNPFASRSIYANKFYSS
EVVSAAAQMTDTALASAALKVADVGTFLWIDTRDKISVVEDGIKDVPCGEIAALVIYDLP
GRDCAAKASNGELAVGEIDIYKTEYIDPIVAIFKKYPNTAIALVIEPDSLPNLVTNSNLQ
TCKDSASGYREGVAYALKQLNMPNIAMYIDAGHGGWLGWNDNLKPGAKELATVYKNAGSP
KSVRGVATNVAGWNAWDLSPGEFSKATDAQWNKAQNEKKYIELFSPELKSAGMPGQAIVD
TGRNGVTGLREEWGNWCNVNGAGFGVRPTSNTGSSLVDSFVWVKPGGESDGTSDSSATRY
DSFCGKSDSFKPSPEAGQWNQAYFEMLVKNAKPAL

Enzyme Prediction     

EC	3.2.1.91:55	3.2.1.4:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	63	356	1.9e-86	0.9591836734693877

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	6.41e-156	71	359	1	293	Glycosyl hydrolases family 6.
227616	CelA1	3.12e-47	45	395	24	443	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBY00792.1|GH6	1.07e-262	1	394	1	395
QRD00977.1|GH6	7.61e-243	1	395	1	399
CAE7007458.1|GH6	7.52e-237	1	394	1	392
AEO59280.1|GH6	1.51e-197	10	394	7	394
ACH15009.1|GH6|3.2.1.91	1.51e-197	10	394	7	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4I5R_A	1.58e-117	44	394	1	356	Crystal structure of a fungal chimeric cellobiohydrolase Cel6A [Humicola insolens]
3VOG_A	4.27e-117	38	395	1	362	Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOH_A Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOI_A Chain A, Cellobiohydrolase [Coprinopsis cinerea]
4A05_A	1.81e-116	43	393	5	362	Chain A, Cellobiohydrolase Family 6 [Thermochaetoides thermophila]
4I5U_A	1.81e-116	44	394	1	356	Crystal structure of a fungal chimeric cellobiohydrolase Cel6A [Humicola insolens]
3VOJ_A	6.91e-116	38	395	1	362	Chain A, Cellobiohydrolase [Coprinopsis cinerea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2AE04|CEL6C_PODAN	1.37e-182	1	395	1	397	1,4-beta-D-glucan cellobiohydrolase CEL6C OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=CEL6C PE=1 SV=1
sp|P49075|GUX3_AGABI	3.76e-120	43	395	88	438	Exoglucanase 3 OS=Agaricus bisporus OX=5341 GN=cel3 PE=1 SV=1
sp|Q0CFP1|CBHC_ASPTN	5.03e-117	43	394	110	467	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=cbhC PE=3 SV=1
sp|A1CCN4|CBHC_ASPCL	2.86e-115	43	394	106	463	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=cbhC PE=3 SV=1
sp|A2QYR9|CBHC_ASPNC	2.78e-114	43	394	98	458	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=cbhC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000274	0.999700	CS pos: 31-32. Pr: 0.6453

TMHMM  Annotations     

There is no transmembrane helices in OAG21367.1.