CAZyme Information: OAG21351.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG21351.1
• CAZy Family: GH30
• CAZyme Description: glucan 1,3-beta-glucosidase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
439		49989.98	6.9506

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441477:1030670-1032039(+)

Full Sequence      

MKSTTLLTCLFAAGVQAWMPADRELPAFNRTSNYLSKRAHSLPSWKIRGVNLGGWLLSEP
WMMNQEWSDMGCGDSCSEFDCVNKLGQSQANTAFNGHYSRWITPSMIQDIHNAGLNTIRI
PIGYWSLHSLVGSGEHFPEMDLKYLDAVIQKAADLGMFVVIDLHGAPGSQKVGDAFTGQV
SLRVLDLPGFFSQANYDRATKWLDWMTKRIHNTPSYRATVGIIEVVNEPQTSRDKGGMPQ
AEKDTLTQKYYPQALAAVRNAENSLGISDDQRLHVQFMDSQWGAGNPKSNLPSDSKIIFD
DHNYVGGAVTSNNPSATQGDYMYYTCYTDNRQTDGDNPKIVQEWSLTVANEYTTEFDWKN
DNNIPFYKQWFIAQQRLYEKTNGWIFWTWRTQLNDPRWDYSYLVYKQWVPTSAAGLDASA
NQDVCKTYFGKRRRSWGRK

Enzyme Prediction     

EC	3.2.1.75:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	86	400	2.5e-108	0.9933333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	3.41e-20	40	405	11	377	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	3.77e-11	101	389	24	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD07072.1|GH5_15	2.30e-249	1	430	1	434
CAE7007615.1|GH5_15	3.75e-246	1	434	1	454
EFY84753.1|GH5_15	3.24e-136	1	428	1	429
UKZ95919.1|GH5_15	2.62e-135	1	425	1	426
UKZ69526.1|GH5_15	3.58e-135	1	428	1	428

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	1.78e-25	47	410	9	379	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	3.52e-25	47	410	14	384	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PF0_A	3.56e-25	47	410	15	385	Chain A, Hypothetical protein XOG1 [Candida albicans]
1CZ1_A	6.15e-25	47	410	9	379	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	6.61e-25	47	410	15	385	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0XRX9|EXGB_ASPFC	3.31e-106	17	400	17	377	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgB PE=3 SV=1
sp|A1DGM6|EXGB_NEOFI	7.52e-106	17	425	17	399	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|Q4X1N4|EXGB_ASPFU	3.75e-105	17	400	17	377	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgB PE=3 SV=1
sp|Q2TZQ9|EXGB_ASPOR	2.32e-103	17	426	18	402	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgB PE=3 SV=1
sp|Q0C8Z0|EXGB_ASPTN	2.46e-102	15	425	18	403	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000725	0.999252	CS pos: 17-18. Pr: 0.9645

TMHMM  Annotations     

There is no transmembrane helices in OAG21351.1.