CAZyme Information: OAG21318.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG21318.1
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:A0A177DPH5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
834	KV441477|CGC6	90845.70	6.0057

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441477:946688-949301(+)

Full Sequence      

MSAKVETVLQSLTLEEKISLLAGKDFWETVPIPDKGVPAIKTSDGPNGARGEVFTGGTRA
ACFPAAVCSAATWDPANAKRIGHALAEETKTKSARVLLAPTMCNHRHPLGGRNFESFSED
PYLAGKMAANVVNGLQEKGIAATIKHFAANEQETDRLKVNEIVSERALREIYMKPFEITI
KEANPLAVMTAYNKVNGTHADSNEFLLKQVLRGEWGWDGLVMSDWGGVNSTADSLNAGLD
LEMPGPTRWRSADTVLEAVKKGQVTEAIITERARNVLRLIEQVGGFENPEIPPEQSIVDP
KHSKLIRDVAGQGITLLKNDGVLPLKREEIKGKTIGLFGLAKEALIHGGGSASLNAHYRI
TPEEGLKTAYGDDVEFKFAKGAATYRLIPPLSKGCKDSEGKDGWTMELFNKGNTSKPIKT
KHGNKEAAFTPLLEQSAKDSEVRFTTTFTPRESGSHYLGCSGIGPTVVHVNDKVVYEQKH
NSPDPMGFLFGGNPEKEFRVPFTKGESYKIQVHSKPPAGESDEGILSGLPGFRLGFMYEE
EHDLDMAAEAKDLAKECDIAIVFTGHTPVWETEGQDQVSFNLPREGSQDKLVETVASVNS
KTIVVNSTGVAVALPWLNKVSALIQAWFPGQEAGNAIADIISGTVNPSGHLPISWPKRIE
DAPAHGNFPGTRDDKGQLTVKYEEGVFVGYRHYDRIAADKIHFPFGFGLSYTTFVLTDAR
VPQSTPEQFAPNVEVTNIGDVAGATVIQVYVGRKDQSAEHPVKTLAAFKKVYLEPRTQAI
VQLECANKDFAYFDEAKGKWTVDQGQYEFSFGQSAGHIEQVVVVDVEGSRGLKL

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	244	1.7e-66	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	3.22e-73	24	376	47	393	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.39e-66	63	812	120	751	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	5.19e-48	543	690	77	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	5.83e-48	36	279	65	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	3.27e-41	1	772	49	729	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7177448.1|GH3	0.0	1	834	1	836
QRC93387.1|GH3	0.0	1	830	1	832
CBX90257.1|GH3	0.0	1	832	1	846
CEI64461.1|GH3	0.0	2	818	3	819
QGI59406.1|GH3	0.0	2	827	3	830

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	3.95e-183	5	827	6	837	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	4.27e-179	5	827	6	837	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.56e-125	1	818	1	660	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.42e-110	1	828	1	665	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.91e-109	4	833	3	720	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	0.0	3	830	9	842	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|Q2U8Y5|BGLI_ASPOR	5.72e-193	5	808	6	813	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	1.10e-192	5	808	6	812	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	1.80e-191	5	807	6	812	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|P27034|BGLS_RHIRD	7.47e-191	5	824	2	808	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999873	0.000157

TMHMM  Annotations     

There is no transmembrane helices in OAG21318.1.