CAZyme Information: OAG21300.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG21300.1
• CAZy Family: GH3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
933		105035.91	6.6401

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441477:898106-901009(-)

Full Sequence      

MTTHVVSLHHLQRCAFNPSNAASFLPYTVDFHESKSNPASPPQPAPPKLNETARESSSTS
IGSARPLSKNAADEQPQSLLKRAPPSHIQLPKTPMRMAEHEDFFTPGQPSAATHFPKPAD
PRGLVRSDAHVPEWGTTGLFFNQPMSRAEPAPPDTILEYAKAQERAQAQKERMKGSHAGK
PTTDPRWATEYTVVPAVQGNGGLTNALRCAVDNKCISDTITVGLIGFPTDSLNEEKKTEI
YEKLEEEHDALTVFVSDKDFDGHYAHYCKTILWPVFHYIIPDHPKSKAFLDHSWVFYVKV
NQAFADKVVKNYKRGDVIWIHDYHLCLVPQMIRQKLPDAQIGFFLHTAFPSSEVFRCLAA
RKELLDGMLGANLVAFQTPEYAHHFLQTCSRILSVEATEDGVQLENRFVNVHSSPIGIDP
RALALAREEPEVLEWITTMQKRYEGKKVIVARDKLDNIRGVRQKLLAFELFLNKNPEWRD
KVVMIQVATSTTEDTELAATVSEIVTRIDAVHSTLTHNPLIFLRQDIAFSQYLALLSIAD
ALAITSLREGMNLTCHEFVICQDGRASDKKYSPVILSEFTGSASVFNGADLAVNPWDYNS
IAEAFRVALEMTDSEKERRYTKLRNTVMHQTGDFWVKNLSTHLAKVHEEQFKRDTMSIPR
LSSSNLARTYQESQRRLFVLDYEGTLASYGSVNNTILANTERVIVVLNDLVADEKNVVYV
MTGRTVRETELIFNRVRGLGLIAENGCFLREPSASEWIQFPEEEKTVKWKDSVKPILQYY
LERVEGSWVEERHCSIIFHYNKPTDKDDSASRHAGDCANHINDACEQQRIKAVPTKDSVV
IEPIDFDKASASQYIFSKYPETARPDFVFAAGNDRSDEGVFRWAEKLKEEWKVPNVQTVT
VGDRNSIAMSTLPNGATGLLGALSKLSKNPRST

Enzyme Prediction     

EC	2.4.1.15:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	190	644	2e-153	0.9305263157894736

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	192	644	19	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	0.0	222	644	49	469	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
184712	PRK14501	8.64e-168	193	914	23	712	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
223457	OtsA	1.38e-159	199	648	42	482	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
215556	PLN03064	2.62e-130	225	800	139	722	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7177637.1|GT20	0.0	1	933	1	921
CBX97101.1|GT20	0.0	1	932	1	913
QRC93131.1|GT20	0.0	24	932	9	920
QDS72670.1|GT20	0.0	24	928	9	909
ATZ46284.1|GT20	0.0	24	928	9	921

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JBI_A	2.97e-101	200	646	27	465	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HUT_A	6.91e-98	200	654	31	478	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HVM_A	7.48e-98	200	646	39	477	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUV_A	9.65e-98	200	654	31	478	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5DXF_A	2.65e-95	184	635	49	515	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14081|TPSX_SCHPO	2.36e-192	191	926	200	941	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E11.16c PE=1 SV=1
sp|Q9UUI7|TPSY_SCHPO	4.53e-180	186	888	162	857	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 100 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22F8.05 PE=1 SV=1
sp|P38427|TSL1_YEAST	4.25e-156	191	865	346	996	Trehalose synthase complex regulatory subunit TSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TSL1 PE=1 SV=1
sp|P38426|TPS3_YEAST	2.32e-154	191	865	314	961	Trehalose synthase complex regulatory subunit TPS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS3 PE=1 SV=3
sp|Q54K57|TPSA_DICDI	6.34e-117	200	800	43	624	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000081	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OAG21300.1.