CAZyme Information: OAG21031.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG21031.1
• CAZy Family: GH3
• CAZyme Description: N-acetylglucosaminyltransferas-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
508	KV441477|CGC3	58296.12	6.8574

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441477:260276-261859(-)

Full Sequence      

MSDSTKDCVIEVGEVASPVVNEKSTPKSSLSVSEIPGRTSSFISEWTPFGLVASYYVFSV
CLYMYCSNSLIAIFWFIYMCTNFYIAGTTVLEAFFSITPCREAREIVTQAQEKEWLFPTP
HHQLPIIDLLIVAYLPNEQDIIMDRALYALEQIDYPSNRIRINILYNTPKAIEPLESELA
ALPQRFPHARVIKVPNSTSKADNLNYFFTLDTGSDIIAIYDCDHYPHPNSPRWAAERFVA
DKQVDIVQGRCIVFNSDDSFMTNMIAVEFDKIYAVSHPGRSTMWGFGLFCGSNGYWRTSL
LRDLKMDDTMLTEDIDSALRAFSKGAKTVHDLNVTSYELAPTTFGAFWKQRLRWAQGWAQ
ASMRHMKMVWNGVKDPLHEEHAKRSFTARFGVLSLLLIRESSYYLVTQYTCLVASFIIVK
FPTSGDELWRLVYFQYPVSQWLFIISIVCLIATLWITNQVKSEYISRRMIILFSVLYPFY
LILNATIGLYGHARQLVNYSSWNPTARK

Enzyme Prediction     

No EC number prediction in OAG21031.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	216	454	2.1e-24	0.9847715736040609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133045	CESA_like	1.56e-36	129	314	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	3.33e-31	68	482	7	392	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133043	CESA_CelA_like	9.03e-29	125	360	1	232	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
133049	CESA_like_2	1.39e-27	125	367	1	239	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.
133059	CESA_CaSu_A2	1.42e-24	123	357	6	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7201725.1|GT2	0.0	1	507	1	508
CBX90388.1|GT2	1.18e-313	1	507	1	504
ATZ50909.1|GT2	5.31e-229	15	507	70	557
CCD48160.1|GT2	6.13e-228	15	507	70	557
APA08880.1|GT2	7.22e-223	15	507	74	561

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	9.85e-12	117	360	118	377	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.04e-11	117	360	130	389	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.04e-11	117	360	131	390	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P96587|YDAM_BACSU	9.81e-14	123	357	47	279	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
sp|P58932|BCSA_XANAC	1.02e-12	118	374	146	397	Cellulose synthase catalytic subunit [UDP-forming] OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsA PE=3 SV=1
sp|Q7XIF5|CSLA7_ORYSJ	2.64e-12	215	359	241	386	Probable glucomannan 4-beta-mannosyltransferase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLA7 PE=2 SV=1
sp|Q84W06|CSLAE_ARATH	1.24e-10	215	357	187	330	Probable glucomannan 4-beta-mannosyltransferase 14 OS=Arabidopsis thaliana OX=3702 GN=CSLA14 PE=2 SV=2
sp|Q84W54|CSLA1_ARATH	1.20e-09	125	357	124	359	Probable glucomannan 4-beta-mannosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=CSLA1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999959	0.000043

TMHMM  Annotations     

Start	End
56	78
402	419
434	456
469	491