CAZyme Information: OAG20570.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG20570.1
• CAZy Family: GH28
• CAZyme Description: endo-beta-1,3-glucanase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
676	KV441478|CGC2	75614.96	7.9338

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441478:212479-214622(-)

Full Sequence      

MGPAQSRLPIAHALSKPTKKDGWLGSLRETRQGIKSTLGYNASTVPDEIPPDNIFTPIQQ
DDILPQIPIGRHHPVPRTGVEDDDRTTMHTNSFYVNAFLGQQNQPIWTHPYSIWWGKGTL
DVGMVQTWGMCISHTEEKDLVFEPGDPAKGYINPLHKQHLVLSAVELDARTTLTTDTHLP
FSVNINLKPHVEAQEPKITFPVVQGMSFITAGYRGATPRIQTGGRGFVDLAGPIVISPRT
VKYRLKDKAGHCWIVYVNPVASLDYDATRFVRLNSNTLLGPPAFKGTIQVAKNPLGLEGE
AIYDRASGAFVCEAKLTAVVLDGKGIYTFRYTKIGTSPLLMFALPHHVQSLDPEMRNQVT
NLCLRTTTKGMATAIWGDKLTFIEPNLPLTMHFSPWNPTMNANAKIRYPPEVLAFIAAVA
ERDLRRAMTERIPQDSLYFAGKSLAKFATIVWIIKDVLSHDAIATAGLEKLKVELARYVD
NAQRHPLYYDDSWKGVVSSAGFSDPGADFGNTYYNDHHLQYAYFVYMASVIGALDPAWLT
QGDNKSWTNMLVKDFAESDYNGRDYPFSRSFDWWHGHSWAKGLFEAADGKDVESTGEDAF
ASYAVKMWRKVVGDADMEKRGNLQLAIQARSFNHYMYIRSTNTNHPLRYTQNKVAGVLFE
NKVDHASTYSRQVLGL

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	72	667	2.6e-161	0.8456591639871383

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	1.70e-167	37	669	35	661	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	1.18e-148	407	669	1	261	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	1.32e-133	73	398	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE6996173.1|GH81	0.0	1	671	4	673
CBX91524.1|GH81	0.0	9	670	8	668
QRC99539.1|GH81	0.0	23	669	22	667
BCS08078.1|GH81	2.56e-175	53	673	179	798
BCR95538.1|GH81	9.14e-175	53	673	224	843

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	6.64e-63	52	671	6	631	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	9.26e-63	52	671	31	656	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.07e-60	52	671	6	631	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	8.71e-17	488	621	392	520	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	4.81e-13	341	637	279	560	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	4.55e-163	43	669	182	805	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	8.27e-115	53	672	2	612	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	5.21e-109	53	673	46	648	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q12168|ENG2_YEAST	3.74e-103	52	672	73	688	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|P53753|ENG1_YEAST	4.20e-90	79	669	427	1018	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OAG20570.1.