CAZyme Information: OAG19924.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG19924.1
• CAZy Family: GH18
• CAZyme Description: mannosyl phosphorylinositol ceramide synthase SUR1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333	KV441480|CGC2	38787.80	9.4427

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441480:881581-882678(-)

Full Sequence      

MRRGVTIFLLVTIVVLGFAVHSVWTLLGLLIASGREDAILRGELPAPNSSAINETPQLIP
KIIHQTYINESIPAHWKGPQQSCLDLHPDYEYKLWTDKKSREFIAAEYPWFLETFDGYPY
PIQRADAIRYFVLHHFGGIYIDLDDGCNRSLDPLLAYPAWVRRTIPTGISNDAMGAVPRH
PFFLKAIDSLTDYNRRWPLPYITVMASTGPLFLSLVWRHYNNASPVDENRVRILFPEEYN
NHPWSFFTHHLGNSWHRTDVKIIFWLAKHWLLVTILGFVVGFTILGMLYKFFVLNKRSTG
PGSPKMRLFNQRMPFYRRISQKRSFELDDRHEV

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	76	155	3e-23	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.15e-75	43	322	65	347	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.57e-27	73	157	1	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7009206.1|GT32	1.25e-236	1	333	1	332
CBY00993.1|GT32	8.22e-225	1	333	1	337
QRD00626.1|GT32	3.42e-217	1	333	1	337
QDS70160.1|GT32	1.59e-152	2	321	3	319
QGA21998.1|GT32	2.72e-145	1	320	1	332

PDB Hits     

OAG19924.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	1.20e-101	1	285	1	281	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	1.83e-99	1	285	1	289	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	4.16e-85	59	291	57	290	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	8.40e-85	44	290	65	316	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	3.52e-59	59	300	64	306	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.928520	0.071493

TMHMM  Annotations     

Start	End
7	29
270	292