CAZyme Information: OAG19897.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG19897.1
• CAZy Family: GH17
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
824	KV441480|CGC4	91246.12	6.3724

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441480:811166-813837(-)

Full Sequence      

MADIDVEEILSRLSVAEKCDITAGLDFAHTVPIPRLGIPSLRTSDGPNTVRGTRFFNSTP
TICLPAGPALAASWNRELLREVGGLLADECIAKGTHVLLAPCVNIPRSPLAGRGHEALGE
DPLLAGTLAGYMCIGIQEKGIVATPKHFLCSDQEQGCFSMNCMVTERALREIYLMAFMLT
IKICDPGAIMAAYNKINGLHITEDKRILHDILRKEWGFRGLVMSDWHGLYATTTPIQAGL
DLEMPGPSQWRGKNLLHSLLANRLSARDLDNCVRRILNMIKEAASSNIPEQAPEKPLNRE
KDRELLRRAATESIVLMKNDESILPLNPDKAIAVIGPNAAIAAYRGGRIAHLRPYYAVTP
LQAISERSNGSVQFSRGIYNHKERPLLGHQLLTSHGKPGFDMYIYNEPPTVADRTPVDHY
EFLNSCGYFFNYENMKRIDGENWHVDISGRLVATDTGPYDFGVSVQGTANLYLDGKLVVD
NTKDQQFGEGFFRAGTVEKIGTVHLTKGESYHVLVHWAGAHTSELIKNSPLTFHPGGLRL
GGCYQMDVAASIRAAAELASQVDQVVILAGLMGDWENEGADRPDIELPQHTDDLITSVLD
ANPNAVASRTKALLHVWYGGNETGTAISDVLYGDANPSGKLPLSFPVCLRDNPTYLCSQA
ERKRILYAEDVYVGYRYYDTLEKPVLFPFGHGLSYTEFRLSKLRLEIHGSQEKAVITARV
QIENIGNFDGAEVVQVYVEPQKFSVGRPVKELKGFEKTHVLKLSSTTTLAINLELKYALG
FWDEAEGRWVCEKGKYNILVGTSSRGTFLREVYSLEETFWWQGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	245	3.3e-57	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	5.89e-77	35	805	101	755	beta-glucosidase BglX.
224389	BglX	5.57e-64	26	339	48	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	1.63e-39	20	279	50	316	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	2.01e-38	314	675	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.36e-32	33	768	76	738	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS12335.1|GH3	2.07e-278	1	824	17	846
BCS00565.1|GH3	2.07e-278	1	824	17	846
BCS04055.1|GH3	7.49e-277	1	824	1	839
BCS15658.1|GH3	7.49e-277	1	824	1	839
BAE61980.1|GH3	1.21e-275	1	824	1	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.75e-203	1	824	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	8.73e-198	5	824	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.90e-113	4	818	3	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.40e-91	10	816	9	664	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	3.76e-91	6	817	4	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2U8Y5|BGLI_ASPOR	2.16e-276	1	824	1	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	1.23e-275	1	824	1	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|A1CA51|BGLI_ASPCL	3.86e-274	1	824	1	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	7.15e-272	1	824	1	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|A2R989|BGLI_ASPNC	3.81e-269	23	824	2	818	Probable beta-glucosidase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999989	0.000054

TMHMM  Annotations     

There is no transmembrane helices in OAG19897.1.