CAZyme Information: OAG18500.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG18500.1
• CAZy Family: GH125
• CAZyme Description: endoglucanase A precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
245		26045.26	8.4123

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441483:244672-245465(-)

Full Sequence      

MKFSALLIASTASLALAVPTATIQKRADYCGQWDSTVTGDYTVYNNLWGQADATSGSQCT
GVDGLSGRSLKWHTSWSWTGGPGHVKSYANVVTKITQKAVSSIKSLPSVWKWTYAGDDLV
ANVSYDLFTSSKVDGSPEYEIMIWVGALGGAGPISATGSPIATVNLAGNTWKLYNGKNGQ
MNVFSFVAEKQVNNFNGDLMTFVKEITSKHGLPSSQILTSVGAGTEPFSGNKAKLTVTEY
SLSQS

Enzyme Prediction     

EC	3.2.1.4:15	3.2.1.151:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH12	98	242	1.6e-42	0.967948717948718

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396303	Glyco_hydro_12	2.96e-54	39	243	1	205	Glycosyl hydrolase family 12.
235746	PRK06215	3.24e-22	2	210	16	203	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7030442.1|GH12	3.90e-123	1	242	1	242
QRC91755.1|GH12	4.51e-118	1	245	30	278
CBX99520.1|GH12	9.27e-118	1	243	497	739
AAS22565.1|GH12	2.64e-109	1	243	1	242
AAN89225.1|GH12	2.64e-109	1	243	1	242

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VL8_A	1.12e-86	20	243	5	227	Crystal structure of XEG [Aspergillus aculeatus],3VL9_A Crystal structure of xeg-xyloglucan [Aspergillus aculeatus],3VL9_B Crystal structure of xeg-xyloglucan [Aspergillus aculeatus]
4NPR_A	3.37e-84	29	243	27	241	Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus],4NPR_B Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus]
3VLB_B	9.66e-84	27	243	5	220	Crystal structure of xeg-edgp [Aspergillus aculeatus],3VLB_D Crystal structure of xeg-edgp [Aspergillus aculeatus]
6K9D_A	9.32e-58	30	243	4	216	Chain A, GH12 beta-1, 4-endoglucanase [Aspergillus fischeri]
5GM3_A	1.55e-56	27	243	1	217	Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus],5GM3_B Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BG78|XGEA_EMENI	4.68e-97	1	245	1	239	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgeA PE=1 SV=1
sp|Q0CRC9|XGEA_ASPTN	1.29e-94	1	243	1	248	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=xgeA PE=3 SV=2
sp|B8N3L3|XGEA_ASPFN	7.49e-94	1	243	1	238	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=xgeA PE=3 SV=1
sp|Q2UK93|XGEA_ASPOR	7.49e-94	1	243	1	238	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=xgeA PE=3 SV=1
sp|A2Q877|XGEA_ASPNC	3.21e-88	8	243	4	239	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=xgeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000257	0.999738	CS pos: 26-27. Pr: 0.9612

TMHMM  Annotations     

There is no transmembrane helices in OAG18500.1.