CAZyme Information: OAG18156.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG18156.1
• CAZy Family: GH109
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
172		18832.22	5.8219

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441484:265993-266511(-)

Full Sequence      

MDQQLVFDLNQAAIDGVRAAGATKQYITPEGNSWTGAWTWISSGNGASLVNLKDPQNKLV
YQMHQYLDTDGSGTSANCVSATIFKERLQAATKWLKDNKKQGLIGEFAGGNNAQCISALQ
DGLKYMGANSDVWLGGIWWAAGPWWGDYIYNMEPTTGVAWTGILPKIKSYFL

Enzyme Prediction     

EC	3.2.1.4:38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	1	149	6.8e-60	0.5212765957446809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	1.84e-26	6	142	143	272	Cellulase (glycosyl hydrolase family 5).
225344	BglC	5.89e-08	11	169	205	386	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBX91913.1|GH5_5	6.47e-108	1	172	161	331
QRD01911.1|GH5_5	9.75e-108	1	172	193	365
CAE7192858.1|GH5_5	1.31e-105	1	172	162	333
ARO48344.1|GH5_5	7.45e-102	1	172	159	330
AAB51451.1|GH5_5|3.2.1.4	4.55e-84	1	170	163	332

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5I77_A	3.20e-78	1	170	134	301	Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger]
5I79_A	2.76e-77	1	170	136	303	Crystal structure of a beta-1,4-endoglucanase mutant from Aspergillus niger in complex with sugar [Aspergillus niger],5I79_B Crystal structure of a beta-1,4-endoglucanase mutant from Aspergillus niger in complex with sugar [Aspergillus niger]
5I78_A	2.85e-77	1	170	137	304	Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger],5I78_B Crystal structure of a beta-1,4-endoglucanase from Aspergillus niger [Aspergillus niger]
1GZJ_A	4.49e-76	1	170	136	303	Structure of Thermoascus aurantiacus family 5 endoglucanase [Thermoascus aurantiacus],1GZJ_B Structure of Thermoascus aurantiacus family 5 endoglucanase [Thermoascus aurantiacus]
1H1N_A	2.64e-75	1	170	137	304	Atomic resolution structure of the major endoglucanase from Thermoascus aurantiacus [Thermoascus aurantiacus],1H1N_B Atomic resolution structure of the major endoglucanase from Thermoascus aurantiacus [Thermoascus aurantiacus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UPQ4|EGLB_ASPOR	7.99e-80	1	170	164	331	Probable endo-beta-1,4-glucanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglB PE=3 SV=1
sp|B8MW97|EGLB_ASPFN	7.99e-80	1	170	164	331	probable endo-beta-1,4-glucanase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=eglB PE=3 SV=1
sp|Q96WQ8|EGLB_ASPKW	1.44e-77	1	170	164	331	Probable endo-beta-1,4-glucanase B OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=eglB PE=3 SV=1
sp|A1DME8|EGLB_NEOFI	5.31e-77	1	170	160	327	Probable endo-beta-1,4-glucanase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglB PE=3 SV=1
sp|Q1HFS8|EGLB_EMENI	8.35e-76	1	170	159	326	Endo-beta-1,4-glucanase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OAG18156.1.