CAZyme Information: OAG17882.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG17882.1
• CAZy Family: GH10
• CAZyme Description: seven-hairpin glycosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1038		115117.03	5.4914

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441485:420514-423679(+)

Full Sequence      

MPGGAPFQLLCVFLLWIACWTAPGHGMTDEAISELRQETRDIFYHGYDNYMEHAFPEDEL
RPLTCAPLTRDRQNPTHIEVNDVLGNYSLTLIDSLSTLAILASTPPLDAPASNNALDDFQ
AGVKLLVENYGDGTPGPRGRGARARGFDLDSKVQVFETVIRGVGGLLSSHQFAVGDLPIR
GYNATTEKRQGRQGIFWPNGFVYDGQLLRLATDLTDRLLPAFNTPTGLPYPRVNLRYGVP
FYAKSPNNMDAEHGQCGRDPNDKGTEVTETCSAGAGSLVLEFSVLSRLTGDPKYERLAKD
AFWAVWHRRSSIGLIGAGIDAETGQWVNAYTGIGAGIDSFFEYALKSHILLSGLPFDQEN
AATDSPDAFLATWLDAHDGIKRQIYRGAQHQHPHYAQVDLYTGAIRAWWIDSLSAFYQGL
LTMAGKLDEAIETHLLYTALWTRYSAMPERWSTATGNIEHGLRWWGGRPEWIESTWYLYQ
ATKDPWYLHVGEMALRDIKRRCWTKCGWAGLQDVRTGELNDRMESFFLGETAKYLFLLFD
PSHPLNTWDAPFVFTTEGHPLIVPKRLRSVHKTRPGSSPVFEAPEICPLPPAHLPFSISA
TAARTDVYHAASLAKLHLMPTIETLDSPLVEFSADHPSVSLSDIRSPSNYTYYPWTLPPA
LIPYNATSSPLAVRTTFDLSFPNMPSTSLVGALQRVDEGILVNSMSGLRLGMVREQDKSR
AIEQKLDLDEQFRIYAISNIALGRDEKVFMSRSTIDNFNPLDPYFTRTRDSHTLDLVIDV
PPQPATASSNTLSDILSDALGDMSNLSDLDIADVIDLEVDPEALENEPSYLSNFLSSLQA
LLSVPSPTSTSSAPKSQNNNQQNAKRHFFPAALPTGPGAAPMPDTKDPDMSYSSNNPLIW
SNVYVHATTLCTERLPLEVAKQYQIIAIPRGDCSFSTKLHNIPAYPPSPASLQLVVIVSF
PEHEENRHADPAQPPVQPLLDDVQHTPTGILRPNPIPMIMVGGGEDTIRLLRRANGVGIR
RRYYFRSQGVKIGNLIVL

Enzyme Prediction     

No EC number prediction in OAG17882.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	43	562	3.5e-144	0.9932735426008968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	1.04e-137	43	563	2	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	5.06e-60	27	565	65	520	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7031766.1|GH47	0.0	35	1038	6	1007
CBX91276.1|GH47	0.0	2	1038	15	1057
QRC90931.1|GH47	0.0	1	1038	14	1040
QDS72860.1|GH47	0.0	27	1038	35	1055
AUW31064.1|GH47	0.0	36	1022	33	1037

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4AYO_A	3.66e-39	28	539	6	413	Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 [Caulobacter sp. K31],4AYP_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with thiomannobioside [Caulobacter sp. K31],4AYQ_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with mannoimidazole [Caulobacter sp. K31],4AYR_A Structure of The GH47 processing alpha-1,2-mannosidase from Caulobacter strain K31 in complex with noeuromycin [Caulobacter sp. K31],5MEH_A Crystal structure of alpha-1,2-mannosidase from Caulobacter K31 strain in complex with 1-deoxymannojirimycin [Caulobacter sp. K31],5NE5_A Crystal structure of family 47 alpha-1,2-mannosidase from Caulobacter K31 strain in complex with kifunensine [Caulobacter sp. K31]
5KKB_A	2.35e-30	29	560	16	464	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	2.65e-30	29	560	14	462	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]
5KIJ_A	1.47e-29	41	561	11	449	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	1.59e-29	41	561	16	454	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O94726|MNL1_SCHPO	7.64e-122	10	587	10	496	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnl1 PE=3 SV=2
sp|Q925U4|EDEM1_MOUSE	1.92e-115	33	570	123	588	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1
sp|Q92611|EDEM1_HUMAN	6.23e-114	33	570	128	593	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens OX=9606 GN=EDEM1 PE=1 SV=1
sp|P38888|MNL1_YEAST	6.60e-108	10	572	11	511	ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNL1 PE=1 SV=1
sp|Q9SXC9|MNS5_ARATH	1.26e-95	34	563	36	478	Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000202	0.999775	CS pos: 26-27. Pr: 0.9734

TMHMM  Annotations     

There is no transmembrane helices in OAG17882.1.