CAZyme Information: OAG17828.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG17828.1
• CAZy Family: GH10
• CAZyme Description: pectate lyase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
255		26277.98	9.0969

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441485:291168-292040(-)

Full Sequence      

MKFSIAIIAAITGFAAAGPAASAPSEFFSLAKRASLPIPASKGSVTYKKPQEISGTFDGG
MKTYGRGASCTGQVEGGDKDAVFLIKNGGTLKNAIIGKDQIEGVHCEGSCTIENVWWVDV
CEDALSLKGDGNAMIKGGGAQSADDKVIQHNGKGTVTIDGFTVMNFGKLYRACGNCKNSV
SRSVVIKNVKAYNGKVLAGINPNFGGTATISGTCASSVKTICEEFKGTKPGSEPKSVSKG
PSSYCKYTASAIKSC

Enzyme Prediction     

EC	4.2.2.2:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	42	227	7.3e-78	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	4.58e-111	35	232	1	200	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7032127.1|PL3_2	7.25e-163	1	255	1	255
QRC92657.1|PL3_2	2.58e-145	1	255	1	257
CEI66276.1|PL3_2	4.33e-127	1	255	1	254
CZS77943.1|PL3_2	2.50e-126	1	255	1	254
QPC67983.1|PL3_2	2.50e-126	1	255	1	254

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3B90_A	8.31e-28	67	252	22	223	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B90_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
1EE6_A	1.60e-27	56	231	16	187	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
3B4N_A	5.81e-27	37	252	111	341	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B4N_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_A Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
4EW9_A	1.94e-23	56	191	21	158	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	1.98e-23	56	191	22	159	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B7Z3|PLYE_EMENI	9.19e-108	24	248	22	248	Pectate lyase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyE PE=1 SV=1
sp|A1DBJ7|PLYE_NEOFI	4.08e-104	24	247	22	247	Probable pectate lyase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyE PE=3 SV=1
sp|A1C4B8|PLYE_ASPCL	9.51e-103	24	255	22	254	Probable pectate lyase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=plyE PE=3 SV=1
sp|Q4WC29|PLYE_ASPFU	3.85e-102	24	247	22	247	Probable pectate lyase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyE PE=3 SV=1
sp|B0Y9M8|PLYE_ASPFC	3.85e-102	24	247	22	247	Probable pectate lyase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000321	0.999678	CS pos: 17-18. Pr: 0.9792

TMHMM  Annotations     

There is no transmembrane helices in OAG17828.1.