CAZyme Information: OAG17436.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG17436.1
• CAZy Family: CE5
• CAZyme Description: heme peroxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
327		34596.28	8.0774

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441486:128416-129452(-)

Full Sequence      

MYIRNVLISGLAAASTVQAYSNYTIREEEWIVAPPAPVQEKRTIGRILGLFGGLFGGNKE
PAQECPAIWTQISSTLTQQFLGDGQCTDAARAAIRSSFHDCFNGACDGSLILAQECSNTE
NRGLERLCGNLANVASQTKVGVADLIQFAAAHAVKTCPGGPTIPVKVGRKDSSEANALGV
LPSGFAKGGDLVKLFASKGFSPYDLAALIGAHTAAKQRVTDPSKAGAALDSTVGTWDNKY
YSETKRGSAPFTLESDKNIAQNPLTAIPFSTFAASKGMWDSAFVGAMVKMSMLGVEDTNL
IDCTSALPGGSKKRDVKSSNLFDRLKW

Enzyme Prediction     

No EC number prediction in OAG17436.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA2	69	295	2.1e-48	0.9921568627450981

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173826	ligninase	5.44e-67	68	308	16	288	Ligninase and other manganese-dependent fungal peroxidases. Ligninases and related extracellular fungal peroxidases belong to class II of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class II peroxidases are fungal glycoproteins that have been implicated in the oxidative breakdown of lignin, the main cell wall component of woody plants. They contain four conserved disulphide bridges and two conserved calcium binding sites.
173827	secretory_peroxidase	3.48e-34	94	295	37	283	Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites.
173823	plant_peroxidase_like	4.43e-30	84	291	9	254	Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase.
395089	peroxidase	2.97e-29	88	219	14	156	Peroxidase.
173825	ascorbate_peroxidase	5.66e-18	94	296	34	251	Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7196231.1|AA2	2.45e-171	1	327	1	335
QCC62988.1|AA2	1.20e-167	1	327	1	318
QRC96194.1|AA2	2.29e-156	1	327	1	339
QDS68272.1|AA2	5.06e-84	64	314	151	410
QDS74803.1|AA2	6.36e-70	41	308	23	291

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ABQ_A	2.51e-31	78	308	25	283	CRYSTAL STRUCTURE ANALYSIS OF FUNGAL VERSATILE PEROXIDASE FROM PLEUROTUS ERYNGII. MUTANT VPi-SS. MUTATED RESIDUES T2K, A49C, A61C, D69S, T70D, S86E, A131K, D146T, Q202L, Q219K, H232E, Q239R, L288R, S301K, A308R,A309K AND A314R. [Pleurotus eryngii]
2VKA_A	1.01e-29	78	308	25	283	Site-Directed Mutagenesis of the Catalytic Tryptophan Environment in Pleurotus eryngii Versatile Peroxidase [Pleurotus eryngii]
5FNE_A	1.81e-29	78	308	25	283	Crystal Structure Of Fungal Versatile Peroxidase From Pleurotus Eryngii Triple Mutant E37k, H39r & G330r [Pleurotus eryngii]
3FMU_A	2.52e-29	78	308	25	283	Chain A, Versatile peroxidase VPL2 [Pleurotus eryngii]
5FNB_A	4.85e-29	78	308	25	283	Crystal Structure Of Fungal Versatile Peroxidase From Pleurotus Eryngii Septuple Mutant E37k, H39r, V160a, T184m, Q202l, D213a & G330r [Pleurotus eryngii],5FNB_B Crystal Structure Of Fungal Versatile Peroxidase From Pleurotus Eryngii Septuple Mutant E37k, H39r, V160a, T184m, Q202l, D213a & G330r [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q96TS6|PEM3_PHLRA	1.58e-28	56	319	29	337	Manganese peroxidase 3 OS=Phlebia radiata OX=5308 GN=mnp3 PE=2 SV=1
sp|Q9UR19|VPL1_PLEER	5.71e-28	78	308	55	313	Versatile peroxidase VPL1 OS=Pleurotus eryngii OX=5323 GN=vpl1 PE=1 SV=1
sp|O94753|VPL2_PLEER	7.91e-28	78	308	55	313	Versatile peroxidase VPL2 OS=Pleurotus eryngii OX=5323 GN=vpl2 PE=1 SV=1
sp|C0IW58|LNP_TAICA	4.56e-26	58	308	27	290	Low-redox potential peroxidase OS=Taiwanofungus camphoratus OX=2696576 GN=LnP PE=1 SV=1
sp|P20010|LIG_PHLRA	1.40e-25	64	308	37	313	Ligninase-3 OS=Phlebia radiata OX=5308 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.055107	0.944853	CS pos: 19-20. Pr: 0.8944

TMHMM  Annotations     

There is no transmembrane helices in OAG17436.1.