CAZyme Information: OAG17236.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG17236.1
• CAZy Family: CE4
• CAZyme Description: Six-hairpin glycosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
698	KV441487|CGC5	76719.66	4.9921

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441487:472198-474341(-)

Full Sequence      

MYWTRLLASIASLTTLQLEVLAGSCWRDTTCNGPTEAAFEGPWQGNIYAPSSRTVRPRSV
ITIRDRHPASYPRLVVLRGNGTNVVFDFGIEVGGIASLSYTSNGTGAIGLAFSEASTWIG
EWSDASNGKFAGRDGALYVNITSAGPGTYTMPDEVMRGGFRYMTAFLVTNTGTYVNITDV
QLEISFQPTWSNLRAYQGYFHCNDELLNRIWYAGAYTLQTNAVPSNTGRWVPMLANGWAN
NGTLGPGETIIVDGAKRDRAVWPGDMGIAVPSTFVSTGDLESVKNALQVMFDYQNPDGSF
PEAGPPLLQQNSDTYHMWTMIGTYNYMLYTNDAAFVQKNWARYKRAMEYVYAKVEVDGSG
LFNQTGTRDWARWQTGFNNTEANVILYHTLQTGAKLATWLNDTAMTNGTRLQDLWTLRAT
CLQSAILTHTFDTAYGAFRDNATLTTLHPQDANSMALLFGLVSPSSAQAQSISTALTKNW
TPIGAETPELPGNISPFISSFEIQSHFTVGNTHRALELIRRSWGWYANHPNGTGGSTVIE
GYRTNGTFGYRQERGYGYDPSYVSHAHGWSSGPTSALTEFVVGLRVVEPAGREWVVEPRF
GDLEEAEGGFVTGLGKFRVGWVRNKDGEGYTVGIETPVGTKGSVRLPLEGMGIYMEVVLT
VNGEMIGKEGYTQVDGQLVWDVDGGTYDIQVSRWFDAE

Enzyme Prediction     

EC	3.2.1.174:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	81	646	3e-91	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	4.72e-14	198	478	4	253	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
225922	SGA1	4.73e-05	90	534	133	571	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].
379972	Bac_rhamnosid_C	1.45e-04	583	657	1	74	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ56650.1|GH78	6.29e-313	5	691	6	682
APA15545.1|GH78	5.13e-312	5	692	6	683
QSZ36009.1|GH78	6.71e-308	6	692	8	684
BAU45349.1|GH78|3.2.1.174	5.28e-299	1	692	4	680
QRD88907.1|GH78	6.55e-299	10	692	13	686

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.52e-15	175	651	284	714	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

OAG17236.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.128434	0.871526	CS pos: 22-23. Pr: 0.8371

TMHMM  Annotations     

There is no transmembrane helices in OAG17236.1.