CAZyme Information: OAG17076.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG17076.1
• CAZy Family: CE4
• CAZyme Description: pectin lyase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	KV441487|CGC1	42173.13	8.3119

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441487:100294-101448(+)

Full Sequence      

MHWATLLLGLFEACAAISTINRKACQYPTKKPLDGCPKNTILVGPGRNFSTIQSAVLSLP
NDTTPHHILILPGNYTEQVNVTRPGPVYLFGQTKAPNDQSQNTVNVIWRNATGAGLSTLD
NAYTSVLTVAPTFNASTTGSGPTGNPVPADTPFGNSDFRAYNIDFSNLYAPYSAGPALAV
SVSYANTGFYYCGFYSYQDTVYVGKLGNAYFYKNEIAGQTDFFYGFGTAWIQSSLVSLRS
CGGGITAWKGTNTTFVNKYGVYIHDSDVKKANSSLSITGKCALGRPWNSQHRSIFANCYL
DDSIQPNGYIEWGTTDKRVNFNTTMAEYKDYGPGWNETARLASNVSIVMDRKQYEPYSTL
EKVFQYPFSGKLGNTAWIDRNPER

Enzyme Prediction     

No EC number prediction in OAG17076.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	47	358	2.2e-56	0.9409722222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	5.35e-25	48	342	22	267	putative pectinesterase
395871	Pectinesterase	1.37e-21	48	340	11	271	Pectinesterase.
178606	PLN03043	2.53e-21	39	341	223	498	Probable pectinesterase/pectinesterase inhibitor; Provisional
215367	PLN02682	5.76e-21	48	342	81	342	pectinesterase family protein
178113	PLN02497	1.33e-20	31	341	25	300	probable pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7031983.1|CE8	4.88e-232	1	379	1	379
QRC90521.1|CE8	2.48e-222	1	381	1	382
CBX91374.1|CE8	1.18e-211	1	380	1	381
UJO20230.1|CE8	2.20e-183	4	382	45	425
APA08027.1|CE8	2.90e-159	21	379	26	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	3.52e-21	37	351	7	283	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	4.83e-21	37	351	7	283	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
3UW0_A	2.52e-07	5	304	12	300	Pectin methylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NPS7|PMEA_ASPFN	3.52e-23	1	326	1	289	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1
sp|Q2UBD9|PMEA_ASPOR	6.63e-23	1	326	1	289	Probable pectinesterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pmeA PE=3 SV=1
sp|A2QK82|PMEA_ASPNC	4.62e-22	7	351	6	311	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|Q5B7U0|PMEA_EMENI	8.08e-19	37	327	33	276	Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pmeA PE=1 SV=1
sp|Q9M9W7|PME22_ARATH	8.27e-16	39	352	240	513	Putative pectinesterase/pectinesterase inhibitor 22 OS=Arabidopsis thaliana OX=3702 GN=PME22 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000398	0.999563	CS pos: 16-17. Pr: 0.9412

TMHMM  Annotations     

There is no transmembrane helices in OAG17076.1.