CAZyme Information: OAG16944.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG16944.1
• CAZy Family: CE4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
526	KV441488|CGC1	59606.42	4.9113

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441488:548649-550276(-)

Full Sequence      

MWLSTTKILLPCVSLLLPSLSLAQCPLYQNYAAHYHEPYTEGTWNLSYARPIVPCRTFRS
RQVEDTIERLRGVIKDVDLFRIFENSWPSTLDTTIEWRGWSNTTSNLDELEGPLMSMKPE
ELTFVITGDIEAMWLRDSANQLQAYVSVLKKDDSPDSLASLFRGAINLQARYILENAFCN
AFQAPDESGVVHKSSLNSDRITPLFDYYKVFSCQWELDSLASFLQLSVDYVTATRDYDFF
QNSSNWTKAVEVVLETAESMTIDSYTEDGEWQHTPYTYCAPYGGTPINNCNGSPHRGNIG
LIRSFHRPSDDACTYQYLIPSNMMFSSALNTSSTITSRIMPRTSGLTARMQALSTAINRG
IEKYGIVSDPTYGKIYAYEVDGYGSVNIMDDPNVPSLLSAPFLGYTTLRDPIYQNTRRKI
LSRDNPYYAVGPVITGVGSPHTLPGRPWPMALIMTILTSEDDTEIVQNLMWLVQSTDGLG
LMHESVHARDKAVWSRQWFSWANGLFGQMILDLEKRRPWILGMSFQ

Enzyme Prediction     

No EC number prediction in OAG16944.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	76	511	6.2e-148	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	76	511	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	4.07e-142	55	524	2	433	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE6998365.1|GH125	0.0	1	526	1	530
CBY01984.1|GH125	8.83e-278	23	523	18	516
QRC95428.1|GH125	3.37e-269	50	526	2	476
QSZ30983.1|GH125	1.72e-175	24	526	27	518
CCD45801.1|GH125	5.24e-174	23	526	21	516

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3P2C_A	1.73e-78	50	513	21	450	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	1.88e-77	45	513	38	468	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	3.75e-76	45	513	18	448	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3QPF_A	7.05e-68	63	512	12	421	Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Streptococcus pneumoniae SP_2144 apo-structure [Streptococcus pneumoniae],3QPF_B Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Streptococcus pneumoniae SP_2144 apo-structure [Streptococcus pneumoniae],3QRY_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 1-deoxymannojirimycin complex [Streptococcus pneumoniae],3QRY_B Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 1-deoxymannojirimycin complex [Streptococcus pneumoniae],3QSP_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 non-productive substrate complex with alpha-1,6-mannobiose [Streptococcus pneumoniae],3QSP_B Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 non-productive substrate complex with alpha-1,6-mannobiose [Streptococcus pneumoniae]
6RQK_A	2.60e-66	70	512	19	421	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	5.62e-126	25	521	27	504	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000211	0.999776	CS pos: 23-24. Pr: 0.9806

TMHMM  Annotations     

There is no transmembrane helices in OAG16944.1.