CAZyme Information: OAG16690.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG16690.1
• CAZy Family: CE12
• CAZyme Description: concanavalin A-like lectin/glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	KV441489|CGC2	38524.16	4.2016

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441489:662648-663759(+)

Full Sequence      

MFSSAALLLAFAASFLLVQVSAECTQFSTNGSTAATYDFYRFYDFRNIRDNIDGDAAAAS
SYGKSYTATESANGQSKIIEAAPWNSGWNARDWFRPSPKNDTIDMHYKPSRVSISNNTDK
SEEHSTYLSLHTTRLSDGSQLAAELDFAEYNVTFASIRMSARIHGASGAIAGFFTYHDDT
SESDIEIPTGGSAEEVHYSNQPTTDPDTGVAINGATFNVSMEAHQPTSTWNNYRLDWVDG
RSAWYMNGAQSADTEVNVPDKESMIILSLWSNGGTFSGRMDIGQDAWFDVQWVELLFNTS
TSASPDTSGTVCSVESSLGSPTPNASPCLRDLVTECIWWAIGVASTVSFMAFM

Enzyme Prediction     

No EC number prediction in OAG16690.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	87	295	2.5e-60	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	2.37e-38	82	294	7	208	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE6998740.1|GH16_22	1.30e-169	1	353	7	359
CBX92358.1|GH16_22	3.27e-52	21	300	39	310
QRC99776.1|GH16_22	6.41e-50	30	300	49	307
BCS21543.1|GH16_22	1.34e-49	15	300	10	289
CAE7012560.1|GH16_22	3.42e-49	33	300	56	311

PDB Hits     

OAG16690.1 has no PDB hit.

Swiss-Prot Hits     

OAG16690.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000196	0.999794	CS pos: 22-23. Pr: 0.9758

TMHMM  Annotations     

There is no transmembrane helices in OAG16690.1.