CAZyme Information: OAG16688.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG16688.1
• CAZy Family: GT90
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463	KV441489|CGC1	51827.03	7.1062

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441489:657408-658799(-)

Full Sequence      

MITVILLVARVPPLHPPVGPPVEKAAPDVELDVEKAICIVEATPEHRTALVIPCHNSDHE
ATSKVLKSAFVHFRPQDIFVVDNGRTRHPVSPEFRNFIRSEHPDINYIWSPIGSKNAAQL
VGAIAAKDYDWIMTVDDDVSIPATFRPPIDKMDDITKGCAFPLKAVDANGDVPLCLVAWQ
DCEYKMSGLTKLAESSICGVLYPHGAGWFCERDTLIDLISNYHSIDFIAEDVNTGLSMQK
MKKRIAFDATCVLETEVPTTVLGPVLNWWNQRYRSWEMGRHGRLIAFADRMLLSLNGQTT
PWGIFTQKFIHLYSIATIIVDWVRIPVFATMGGDPNFWRLGVPLMLAATLPILAFKYFNA
RHRPDLQPRFWAAMTYPLYKQLYSLVSIFGAIRAVIFYAGGHKKPKTIKKMIKDNDPNAV
WLDPRFENNPAYLADEAEALLAAAKEDASKKVPASVYISPASP

Enzyme Prediction     

No EC number prediction in OAG16688.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224136	BcsA	2.38e-09	47	413	55	418	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
395426	Glycos_transf_2	0.001	51	162	3	113	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
132997	Glyco_tranf_GTA_type	0.003	51	139	2	88	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
224137	GT2	0.003	45	174	2	131	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE6998745.1|GT2	7.11e-278	35	463	84	512
QGI62687.1|GT2	2.89e-169	1	442	201	642
QGI93580.1|GT2	2.89e-169	1	442	201	642
CCT66493.1|GT2	8.21e-169	1	442	201	642
QGI79854.1|GT2	3.30e-168	1	442	201	642

PDB Hits     

OAG16688.1 has no PDB hit.

Swiss-Prot Hits     

OAG16688.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.940548	0.059491

TMHMM  Annotations     

Start	End
337	359
382	401