CAZyme Information: OAG16683.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG16683.1
• CAZy Family: CE1
• CAZyme Description: Six-hairpin glycosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
845	KV441489|CGC4	91778.82	4.4092

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441489:646368-648953(+)

Full Sequence      

MIILQRLAFFTVFTNPLATAFVNYGSIIPKSILQQSTPSSSGLRPWANTSLTLSSSNPLV
TLDYGTEVAGFPFFHVSAISGTVQIEVKYSEEYRGVEEPFSDGPWTFSNGLSNTFRVETF
NVTETGYIESFFVQGGQRWQTARLITNGSVTIDHLGFRATSSNLDVDLLPGHLKTSDDTY
NRVFDLGGRVAQVACVDAGNAPSTWEITKDGALVRGQTSAQSSLGVEAANYTLEFDVKIA
RGGAGWRVASALQPLGPYFVLTSEYPQQNTFANTNRTLLPPNILAFNTEWSLVNQSTLPV
PENQYFTINTTIEENTWYRVSTSIEKAGYRIGLNGTEIAFVPLPPPAAPGNFGTPSRYEG
TWGFGGMQDQITYYKDVIVTARNGTIIYSNPLTSEDCLAEYQVAPLDHSVCLDGAKRDRL
VWTGDFYHTVRVVSTSSARFDYLLGTIEYALNYQLDEGPYAGFTPISANLGSRPQYKEAN
IGNYAGLVDYQDLFLAGIGHYYRYTGDLDGLKPYWSQIKRLATARLAFIDPTSGLIGGSP
EIPSPFSFLGPANGTATTGLFAYMLNEIAPLALAIGDEEASTSYSQTASKLREALNRELW
NDQLGTYSLSTTDRGNFSLTGIAWAIISGTANVTQAASSIAKLEELRFAVGYKTVSSDLE
TDDYQLAPNPSGFLLEALFKARRDLGVDSTSAITHLLDNLWGSMVKNNEYYSGASWEYVK
PDGSPGIDLFTSLAHPWGAAPTYVLPEYLLGVVPSSPGYEMVVITPMVGFLNQSEVSGRV
PTPNGPINVAWTLDGTKVVMTVDIPSGTTATLQLPAGAAVVGEDLHDGQLELSCGVKELT
MEIQV

Enzyme Prediction     

EC	3.2.1.40:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	408	814	8.4e-59	0.7321428571428571

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	9.38e-11	751	826	1	75	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	9.61e-07	501	749	110	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407295	Glyco_hydro_36	1.39e-04	498	636	135	292	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
395961	Trehalase	4.84e-04	560	658	311	417	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
183934	treF	8.14e-04	561	669	354	464	alpha,alpha-trehalase TreF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBY00141.1|GH78	0.0	2	835	3	830
USW53135.1|GH78	5.25e-278	17	828	13	811
BCS19496.1|GH78	3.81e-249	48	826	41	822
BCR89915.1|GH78	4.94e-239	47	838	45	839
BCS14345.1|GH78	2.42e-237	52	838	67	856

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	6.43e-15	412	789	331	674	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	1.21e-09	392	748	225	541	Chain A, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

OAG16683.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.025118	0.974858	CS pos: 20-21. Pr: 0.9311

TMHMM  Annotations     

There is no transmembrane helices in OAG16683.1.