CAZyme Information: OAG16360.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG16360.1
• CAZy Family: PL1
• CAZyme Description: UDP-Glycosyltransferase/glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389		43819.02	5.9849

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441490:544391-545689(-)

Full Sequence      

MAKGGGHDPQLHKRQLHLRGGYGEDGTDIAVDELVMEDGVQYLALENEAFVEAFGGTENL
HKAMPRETARYIETGILSARLHDFVSFLQDEINKFSPTHIIFNDGLSMQATSALQMPRIN
ARRIAVIHTAEQLPFGPFAGGMPGMLSSPHESKLLQELDGIWSVSEAIKRYAIDHGKLQT
SFFVHHPWTYLEERNHELPLRLDNWNKKFIGMINPCPVKGAQILVGLAKSCPQHKFLAYK
SWGFDDKCGRQMQAQKNIIIRPTCKDTDELWRNIKLLLVPSLWFEAWGIVTVEAHLRGIP
VISSNAGALPEAMLGLDHVIPVNTMNGDCDEEGAYIVPDQDIAPWASVVNRLMSDEDQYK
RLSDKVRSTTEQWLRDADEKALEKWLTSL

Enzyme Prediction     

No EC number prediction in OAG16360.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340850	GT4_ExpE7-like	3.09e-19	81	368	85	340	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
340831	GT4_PimA-like	2.03e-17	50	372	36	350	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
223515	RfaB	1.87e-14	99	389	88	377	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
340847	GT4_AmsD-like	1.98e-09	255	385	237	349	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.
395425	Glycos_transf_1	2.06e-09	265	367	70	156	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE6996711.1|GT4	3.84e-228	1	389	83	471
QKD50346.1|GT4	2.97e-157	1	389	54	442
AEO63904.1|GT4	3.13e-103	77	389	98	410
AEO58675.1|GT4	3.53e-101	77	389	105	417
CAE85589.1|GT4	3.91e-93	28	389	103	459

PDB Hits     

OAG16360.1 has no PDB hit.

Swiss-Prot Hits     

OAG16360.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000090	0.000000

TMHMM  Annotations     

There is no transmembrane helices in OAG16360.1.