CAZyme Information: OAG16188.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG16188.1
• CAZy Family: AA9
• CAZyme Description: pectin lyase-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390		40862.27	9.8047

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441490:127929-129200(+)

Full Sequence      

MKFLAIAALASLAHMASAVGVVGKAEGFATGVTGGGSATPQYPKDINELTKLLTDATARV
IVLDKTFDYTTSEGTVTGTACASWGTGAKCQRILLDSCDAGQVKETVTYYKAAKTPIKVG
SNKTILGIGNKGIIKGKGLSFAGKNVIVQNIQVSDLNHKYVWGGDALSFAGADLIWIDHV
TTARPGRQHYVFGFTPSTRITLSSNFINGASDYSTGCDGYHYWVFEMVGTGDSITMKNNY
ITKTAGRGPALSGKTLLHAVNNVWFDVKGHLLEGGDAGARGIFEGNVFNNVQNVVADYAG
KLFGSPDANTNKQCSTALGRSCEVNLFQGTTTTASSLTSKKNTSFFSEFKNLGIAKAVAA
SAITTRIPNGAGNGKLSALSARSASAKFRA

Enzyme Prediction     

EC	4.2.2.10:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	106	290	5e-74	0.9946524064171123

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.78e-37	107	285	2	183	Amb_all domain.
226384	PelB	4.37e-09	111	251	91	236	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	3.39e-05	113	269	26	193	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC90282.1|CBM1|PL1_4	1.50e-174	6	390	8	387
AAF22244.1|CBM1|PL1_4|4.2.2.10	2.29e-170	6	372	8	370
BAE64564.1|PL1_4	5.27e-161	1	376	1	375
QRD81306.1|PL1_4	7.48e-161	1	376	1	375
QMW26980.1|PL1_4	7.48e-161	1	376	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	1.82e-116	19	376	1	359	Pectin Lyase A [Aspergillus niger]
1IDJ_A	1.55e-112	19	376	1	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1QCX_A	2.64e-108	20	375	2	359	Pectin Lyase B [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8N6W5|PELA_ASPFN	6.50e-150	7	376	9	375	Probable pectin lyase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelA PE=3 SV=1
sp|Q2UCT7|PELC_ASPOR	6.50e-150	7	376	9	375	Probable pectin lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelC PE=3 SV=1
sp|Q4WV10|PELA_ASPFU	1.77e-118	7	376	9	380	Probable pectin lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pelA PE=3 SV=1
sp|Q0CYL8|PELA_ASPTN	1.41e-114	1	376	1	378	Probable pectin lyase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelA PE=3 SV=1
sp|A1CYC2|PELA_NEOFI	2.00e-114	1	376	1	378	Probable pectin lyase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pelA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000203	0.999756	CS pos: 18-19. Pr: 0.9809

TMHMM  Annotations     

There is no transmembrane helices in OAG16188.1.