CAZyme Information: OAG16139.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG16139.1
• CAZy Family: AA9
• CAZyme Description: Glyco_trans_2-like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A177DB64]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
904	KV441491|CGC5	100958.15	5.6527

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441491:667242-670058(+)

Full Sequence      

MSSATPSHDGDRPFIPSSRQSFSGSVNDSRYSTPQTPTGRPPMSRPLTMKIDEDSRYRAI
IKHLYAKACSMRWMTSSALSPGSCEGVLIRKGQGEYVTEPVAANKDLLSAVKRINPGVAL
TMSTDGTQAIFDVLEPFETELMFQNGSQIQIFESMAEVATSSTIRKFQYAALIRQERLLL
VWHDDLGAILSQAMEIESRILALVWGTSKNPFSGFDSAIQSSANSTLGGSTVDFAIDGKK
DDVEVNAEEVDGDLEKADGPKESLARPLIFTSSIFVGLAMVLIIILVIGLGNKAIILQTM
TDHFYPRILLILTEPLWIALGLFFVVVVMGNIFEVFGPVTGVKSNSRFHSAIKPNLAQAR
AQGFTPSTITIQMPIYTESLEGVVKPTVASLQAAISYYESRGGTARIFINDDGMAVRSEE
DNEKFLRFYENNNIGWVSRPKHNHEGFVRRGKFKKASNMNFALNTSNKVEDVLQSLVDNR
YDKGNASISEEEELALYHEALEQVLTADPRAKAGGNIRMGEIILIVDSDTIVPEDCLMYG
AAEMFLSPEVAIVQHATGVMQVSWDYFENGITYFTNLVYTAIRFSVGSGEVAPFVGHNAF
LRWQAVQSVGNPPEDDGYVCFWSESHVSEDFDIALRLQIKGNIVRLASYHGRGFKEGVSL
SVFDELDRWEKYAYGCNELVFNPVHTWLWKSPFTKLFRTFIFSNIQLSSKISICGYIFSY
YALGSAVPLGALNYFLVGWLNGDLDKYYVESWKIFIVLLIVFNGMSNVCFAIMRYRIGEA
SLLGAFFENLKWMPFFMIFFGGVSFHILLAICSHMFCIDMSWGATAKEKDNSNFFAELPK
IWKRFKWMYMIMIAMIGGMIYLGCFAPHGWEITGLTAVLPWAVTVIMHCLLPIVLNPSLT
VFNY

Enzyme Prediction     

No EC number prediction in OAG16139.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	522	729	1.3e-53	0.9644670050761421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	1.48e-50	522	731	1	190	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
133045	CESA_like	1.50e-09	491	630	45	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	1.05e-06	520	828	138	425	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
236918	bcsA	1.76e-05	368	463	261	335	cellulose synthase catalytic subunit; Provisional
224137	GT2	6.76e-04	513	653	70	222	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7220538.1|GT0	0.0	1	904	1	907
CBX97842.1|GT0	0.0	9	904	10	904
QRD03074.1|GT0	0.0	49	904	1	858
QGA18667.1|GT0	0.0	5	904	26	919
UNI18966.1|GT0	2.53e-310	3	904	4	905

PDB Hits     

OAG16139.1 has no PDB hit.

Swiss-Prot Hits     

OAG16139.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

Start	End
274	296
308	330
720	742
755	777
792	814
848	870
880	902