CAZyme Information: OAG15965.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG15965.1
• CAZy Family: AA9
• CAZyme Description: endoglucanase-5

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
226	KV441491|CGC4	24015.95	6.7471

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441491:233867-234610(+)

Full Sequence      

MVSIKQLTFLALATGLATVDAQSTGKTTRYWDCCKGSCAWSGKAPVSSPIKTCDKNDNPL
SDVNTKSGCDGGSAYMCTDQSPWAVSDDLAYGFAAVKLSGKTESNWCCACYELTFTSGPV
SGKKMVVQTTNTGGDLGDNHFDLAIPGGGVGIFNACTAQFGAPPNGWGQQYGGISSRSEC
ESFPQKLKPGCEWRFDWFKNADNPSVSFKEVTCPKALTDKTGCVRQ

Enzyme Prediction     

EC	3.2.1.4:59

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH45	25	223	7.9e-96	0.98989898989899

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
280233	Glyco_hydro_45	1.91e-90	24	223	1	213	Glycosyl hydrolase family 45.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7218206.1|GH45	4.38e-143	1	226	1	227
QRD02548.1|GH45	5.43e-143	1	225	1	227
CBX97547.1|GH45	1.74e-141	1	226	1	227
AGU16532.1|GH45|3.2.1.4	8.24e-138	1	225	1	227
ACH15008.1|GH45|3.2.1.4	1.66e-126	9	225	9	225

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MVI_A	3.68e-114	8	225	9	223	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]
5GLY_A	4.72e-108	21	225	1	202	Crystal structure of a glycoside hydrolase in complex with cellotetrose from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126],5GM9_A Crystal structure of a glycoside hydrolase in complex with cellobiose [Thermothielavioides terrestris NRRL 8126]
5GLX_A	5.42e-108	21	225	4	205	Crystal structure of a glycoside hydrolase from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126]
1HD5_A	7.79e-107	25	225	3	201	Endoglucanase from Humicola insolens AT 1.7A resolution [Humicola insolens]
1L8F_A	1.04e-105	23	225	1	200	Structure of 20K-endoglucanase from Melanocarpus albomyces at 1.8 A [Melanocarpus albomyces]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P45699|GUNK_FUSOX	8.50e-112	5	225	2	221	Putative endoglucanase type K OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|P43316|GUN5_HUMIN	9.39e-105	25	225	3	201	Endoglucanase-5 OS=Humicola insolens OX=34413 PE=1 SV=1
sp|D3GDK4|GUN_CRYAT	1.28e-100	10	225	11	221	Endoglucanase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
sp|O97401|GUN_PHACE	8.69e-61	25	223	40	240	Endoglucanase OS=Phaedon cochleariae OX=80249 PE=2 SV=1
sp|P18126|GUNB_CELJU	3.63e-55	19	225	263	500	Endoglucanase B OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=celB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000243	0.999734	CS pos: 21-22. Pr: 0.9786

TMHMM  Annotations     

There is no transmembrane helices in OAG15965.1.