CAZyme Information: OAG15292.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG15292.1
• CAZy Family: AA7
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480	KV441494|CGC5	54863.56	5.2978

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441494:176867-178797(-)

Full Sequence      

MSQSYLPKDFLWGFATASYQIEGAPHEDGRADSIWDTFCRIPGKIAGGESGDVACDSYHR
TDEDIALLKDIGAKSYRFSLSWSRIIPLGGRNDPVNEKGLQYYIKLVDDLRAAGIEPMIT
LFHWDLPDNLHKRYGGMLNKDEFVKDYENYARVCFKAFGSKVKYWITFNEPWCSSILGYG
TGLFAPGRCSDRSKSAEGDSSREPWIVGHSLLIAHGAAVKAYRDDFKSKDGGQIGITLNG
DWTEPWDPEDPKDREACDRKIEFAICWFGDPVYFGKYPDSMRKQLGDRLPEFTPEEAALV
KGSNDFYGMNHYCANYIRHKETEPEPEDHVGNLDILYQNKKGEWIGPETQSVWLRPMPLG
FRKLIKWLSDRYGGPTFYVTENGTSLKGENDLPLEKLLDDEFRCEYFRGYIGALADAHTL
DGVDVRGYSAWSLMDNFEWAEGYTTRFGVTYVDYKGGQKRYPKKSAREISKIFDKYIRTE

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	4	474	6.2e-161	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	0.0	6	467	5	442	Glycosyl hydrolase family 1.
274539	BGL	1.50e-170	7	467	1	424	beta-galactosidase.
225343	BglB	1.37e-141	6	467	4	444	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	2.36e-120	6	466	28	473	beta-glucosidase
215455	PLN02849	2.64e-116	2	466	26	473	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE7220638.1|GH1	0.0	1	480	1	480
QRD02870.1|GH1	0.0	1	480	1	480
CBX97760.1|GH1	0.0	20	480	124	584
QRD82378.1|GH1	6.80e-298	2	477	5	480
QMW27934.1|GH1	6.80e-298	2	477	5	480

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	1.14e-273	1	480	21	499	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	2.62e-250	6	480	3	466	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	2.89e-247	6	480	3	466	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	5.79e-247	6	480	22	485	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
3AHY_A	1.18e-243	6	477	9	470	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	4.84e-201	6	477	11	475	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	3.12e-185	1	477	1	460	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q5Z9Z0|BGL24_ORYSJ	4.14e-153	3	467	30	496	Beta-glucosidase 24 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU24 PE=2 SV=1
sp|Q7XKV4|BGL12_ORYSJ	1.32e-150	1	472	34	507	Beta-glucosidase 12 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU12 PE=1 SV=2
sp|B8AVF0|BGL12_ORYSI	1.87e-150	1	472	34	507	Beta-glucosidase 12 OS=Oryza sativa subsp. indica OX=39946 GN=BGLU12 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000015	0.000018

TMHMM  Annotations     

There is no transmembrane helices in OAG15292.1.