CAZyme Information: OAG15271.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG15271.1
• CAZy Family: AA7
• CAZyme Description: Carboxylic ester hydrolase [Source:UniProtKB/TrEMBL;Acc:A0A177D7G9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
286		30559.18	8.4395

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441494:127527-129299(-)

Full Sequence      

MSRQHLALVSGVFAAQLTQVSNYGGSARAKPGMWVYVPDQVKSDALVVAIHSCQSSAQKY
FQNSLIPWKKGSDTKGYVTVWPSSTTECWDVSSKASLSHNGGGDSNAIANMITYAIDKYK
IDPKKVFVTGGSSGGMMSNVLAATYPELISAVSLYSGVPAGCFVSASGAAAAWNNTCSGG
QSISTAQHWGDVVRGMYPGYNGTRPRMQFWHGSVDGTLSPKNYDETLKQWTNVFGVSTTP
TSSKKDTPERNYRTDDFGPSVEGIWAVGVGHSVPSHLTVSEAWFGL

Enzyme Prediction     

EC	3.1.1.72:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	32	187	3.5e-18	0.5903083700440529

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	7.49e-39	33	243	1	207	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
402228	Esterase_phd	1.41e-20	36	229	6	194	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
226040	LpqC	8.13e-19	6	275	15	278	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
224423	DAP2	8.64e-07	75	158	422	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
395257	Peptidase_S9	8.50e-05	114	158	54	98	Prolyl oligopeptidase family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRD02824.1|CE1	4.44e-194	6	286	10	290
CBX97717.1|CE1	7.54e-192	6	285	10	295
VBB83796.1|CE1	3.80e-127	11	286	18	286
CDP30592.1|CE1	1.78e-125	11	286	18	286
CAP71192.1|CE1	1.78e-125	11	286	18	286

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	9.87e-92	14	285	1	273	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WBW4|AXE1_ASPFU	4.49e-94	12	285	29	303	Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=axeA PE=3 SV=1
sp|A1DBP9|AXE1_NEOFI	4.66e-93	8	285	25	303	Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=axeA PE=3 SV=1
sp|A1CSZ8|AXE1_ASPCL	2.27e-92	14	285	33	305	Probable acetylxylan esterase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=axeA PE=3 SV=1
sp|Q96W96|AXE1_ASPFI	3.87e-92	5	285	24	301	Acetylxylan esterase A OS=Aspergillus ficuum OX=5058 GN=axeA PE=1 SV=1
sp|Q8NJP6|AXE1_TALPU	8.18e-92	12	285	32	306	Acetylxylan esterase A OS=Talaromyces purpureogenus OX=1266744 GN=axeA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999954	0.000107

TMHMM  Annotations     

There is no transmembrane helices in OAG15271.1.