CAZyme Information: OAG14731.1

Basic Information

• Species: Alternaria alternata
• Lineage: Ascomycota; Dothideomycetes; ; Pleosporaceae; Alternaria; Alternaria alternata
• CAZyme ID: OAG14731.1
• CAZy Family: AA7
• CAZyme Description: cellulase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389		42042.70	8.0702

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AalternataSRC1lrK2f	13577	N/A	111	13466

• Gene Location: location=KV441498:239769-240938(-)

Full Sequence      

MVQLTQLVLASAAFAGAVSAAPKPPPSNVSINPWTGKDRYVVQSYGKKLDQTIASFTAQN
DTLNAARTRTVAQKISTFTWVTTRDGLSLIPTAIKEARQQRKPGKKMIVGLVLYNLPDRD
CSAGESAGELSLANNGLEIYKKEFVDKYAKLVSQAKDLDFAIVLEPDSLGNAITNQGVPF
CATATPAYEEGIAYAIAKLQFPNVHLYMDAAHGGWLGWADNLKPTAQIFAKVVAMAKKLN
PAAKIRGYATNVSNYNSFQAKVRENYTEYSPSWDESHYASSLAPYLEAEGLPSNFIIDQG
RVALPGARAEWGEWCNVEPAGYGSLPGSKQNNTNVDSLVWIKPGGESDGKCGLAGAPAAG
AWFDEYVQMLVKNADPPLEPTYLKKPKGL

Enzyme Prediction     

EC	3.2.1.91:55	3.2.1.4:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	55	352	2.7e-76	0.9489795918367347

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	1.99e-142	61	351	1	287	Glycosyl hydrolases family 6.
227616	CelA1	7.70e-42	32	375	24	411	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBX92025.1|GH6	9.35e-242	1	387	1	386
CAE7193877.1|GH6	6.32e-231	1	382	1	389
QRD02113.1|GH6	5.94e-228	1	382	1	394
AEO57190.1|GH6	7.05e-165	8	376	6	375
AGV05123.1|GH6	1.49e-161	8	376	6	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1DYS_A	4.35e-122	30	374	2	342	Endoglucanase CEL6B from Humicola insolens [Humicola insolens],1DYS_B Endoglucanase CEL6B from Humicola insolens [Humicola insolens]
3A64_A	1.47e-121	30	382	12	383	Chain A, Cellobiohydrolase [Coprinopsis cinerea],3A9B_A Chain A, Cellobiohydrolase [Coprinopsis cinerea],3ABX_A Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOF_A	2.37e-120	30	382	12	383	Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOG_A	1.54e-85	32	378	8	362	Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOH_A Chain A, Cellobiohydrolase [Coprinopsis cinerea],3VOI_A Chain A, Cellobiohydrolase [Coprinopsis cinerea]
3VOJ_A	2.45e-84	32	378	8	362	Chain A, Cellobiohydrolase [Coprinopsis cinerea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2AC20|CEL6B_PODAN	5.72e-149	9	384	39	417	1,4-beta-D-glucan cellobiohydrolase CEL6B OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=CEL6B PE=1 SV=1
sp|B2ADA5|GH6D_PODAN	6.67e-125	30	376	25	362	Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=GH6D PE=3 SV=1
sp|Q7SIG5|GUN6_HUMIN	2.24e-121	30	374	2	342	Endoglucanase-6B OS=Humicola insolens OX=34413 GN=cel6B PE=1 SV=1
sp|P49075|GUX3_AGABI	1.34e-84	32	378	90	438	Exoglucanase 3 OS=Agaricus bisporus OX=5341 GN=cel3 PE=1 SV=1
sp|G4MM92|CEL6A_MAGO7	1.68e-78	32	378	131	487	1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=cel6A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000228	0.999733	CS pos: 20-21. Pr: 0.9812

TMHMM  Annotations     

There is no transmembrane helices in OAG14731.1.